KEGG   Cynoglossus semilaevis (tongue sole): 103392869
Entry
103392869         CDS       T04866                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
csem04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103392869
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103392869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csem04030]
    103392869
G protein-coupled receptors [BR:csem04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    103392869
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 103392869
NCBI-ProteinID: XP_008327844
UniProt: A0A3P8VXI5
LinkDB
Position
17
AA seq 368 aa
MESSLSNTCYYDHNVTFFYNWVGKKISVAWTTRDFVVIGLGLTVCFIVVLANLMVMVAIF
MNRRFHFPIYYLLGNMAAADLFAGVAYVNLMLNTGPWTSMLTKNQWYIRGALIDISLTAS
VANLLAVAVERHQTILTMQLHSKMSKRRVVLLIVCIWAVGIIMGVVPSMVWNCECHLEDC
STVAPLYSRRFLIFWAVLNLLTFFIMVAMYIRIFIYVRYQSQYTSQHNSEMQHSQTIINL
MKTIFMVLGAFVICWTPGLVTLLLDGLLGKESHANDYEKFCLVIAECNSLVNPIIYSLRD
KEMRQTFKRILCCLFRRVDDQQRQPSPIEIDSPTPKEPLGCVQKSEHEALCFSQETNHKG
DSWTTPGL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggagagcagtctgtcaaacacctgctactatgatcacaacgtcaccttcttctacaat
tgggttggcaagaagatcagtgtggcgtggacgacccgggactttgtggtgattggactg
ggcctgactgtgtgtttcatcgtcgtcctggccaacctgatggtgatggttgccatcttt
atgaaccgtcgctttcacttccccatctattacctcctgggcaacatggctgcagctgat
ctgtttgccggtgtggcctatgtcaacttgatgttaaacacgggcccctggaccagcatg
ttgacaaagaatcagtggtatatccgcggggccctgattgacatcagcctgacggcgtct
gtagccaacctgctggctgtcgccgtcgagcgccaccagaccatcctcaccatgcagctg
cacagcaagatgagtaagcgtcgggttgtgctgctgatagtctgcatctgggcggtgggc
atcatcatgggcgtggtgccctccatggtgtggaactgtgagtgccatttggaggattgc
tccaccgtcgcccccctttacagccgccgtttcctgatcttctgggcagttctgaacctg
ctcaccttcttcatcatggtagccatgtacattcgtatcttcatctacgtcagataccag
agccagtacacgtcgcagcacaactcggagatgcagcacagccagaccattatcaacctg
atgaaaactatcttcatggttctcggtgcttttgtaatctgctggacgccaggccttgtg
actctcttactggatgggcttctgggtaaagaaagccacgccaacgactacgagaagttc
tgtttagtcatagccgagtgcaactctctggtcaatcccatcatctattccctccgggac
aaagagatgaggcagacgttcaagcggatcctgtgttgcctctttcgcagagtggatgat
cagcagaggcagccctcacccattgagattgactcacccacacctaaggaacctctaggg
tgtgtccagaagtctgaacatgaggctttgtgtttctcacaagaaacaaaccataaagga
gacagttggacaactccggggctttga

DBGET integrated database retrieval system