KEGG   Cynoglossus semilaevis (tongue sole): 103393055Help
Entry
103393055         CDS       T04866                                 

Gene name
aldh7a1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00053  Ascorbate and aldarate metabolism
csem00071  Fatty acid degradation
csem00260  Glycine, serine and threonine metabolism
csem00280  Valine, leucine and isoleucine degradation
csem00310  Lysine degradation
csem00330  Arginine and proline metabolism
csem00340  Histidine metabolism
csem00380  Tryptophan metabolism
csem00410  beta-Alanine metabolism
csem00561  Glycerolipid metabolism
csem00620  Pyruvate metabolism
csem01100  Metabolic pathways
Module
csem_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
csem_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103393055 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    103393055 (aldh7a1)
   00620 Pyruvate metabolism
    103393055 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103393055 (aldh7a1)
   00561 Glycerolipid metabolism
    103393055 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    103393055 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    103393055 (aldh7a1)
   00310 Lysine degradation
    103393055 (aldh7a1)
   00330 Arginine and proline metabolism
    103393055 (aldh7a1)
   00340 Histidine metabolism
    103393055 (aldh7a1)
   00380 Tryptophan metabolism
    103393055 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103393055 (aldh7a1)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103393055 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     103393055 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     103393055 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103393055
NCBI-ProteinID: XP_008328099
LinkDB All DBs
Position
2
AA seq 542 aa AA seqDB search
MQRCLTLTFARHSRLLLRHKFATVHCQQTAAMSSLLINQPKYSWLKELGLSEDNHGVYNG
SWVGSGEVVTSYCPANNEPIARVTQATLAEYEETVQKTKEAWKVWADIPAPKRGEIVRQI
GDALRKKIKVLGSLVSLEMGKIYVEGVGEVQEYVDICDYAVGLSRMIGGPILPSERPGHA
LIEQWNPVGLVGVITAFNFPVAVYGWNNALALTCGNVCLWKGAPTTPLTSVAVTKIVAEV
LEANNLPGAICSMTCGGADIGTAMAKDERVDLLSFTGSTHVGKMVGMMVQERFGRKLLEL
GGNNAIIVFEDADLNLVVPSAVFASVGTAGQRCTTTRRLILHESVHDTVVERVAKAYKQV
RIGDPWDPSTLYGPLHTKQAVEQYQSAIEQAKQQGGTVVCGGKKMDRPGNYVEPTIITGL
AHDAPIVHTETFVPILYVLKFKTEEEAFALNNEVKQGLSSSIFTKDMGRVFRWLGPKGSD
CGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKQYMRRSTCTINYSKDLPLAQGIK
FE
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgctgcctcaccctgaccttcgcccggcacagcaggctccttttaagacataag
tttgcaactgtccactgccagcagacagcagctatgtcaagccttctcatcaaccagccc
aaatactcctggctgaaagagcttggtctttcagaggacaaccatggtgtttacaatggt
agctgggttggtagcggggaggttgtcacatcctactgccctgctaacaatgagccaatt
gccagagtaacccaggctactcttgccgaatatgaagagactgttcagaagacaaaggaa
gcttggaaagtctgggcagatattcctgctccaaaaagaggggagattgtcaggcagatt
ggtgatgcccttagaaagaaaatcaaggtccttggaagtctggtgtctctagaaatgggc
aaaatctatgttgagggagtgggtgaggttcaggaatatgttgatatctgtgattatgct
gtaggtctgtctaggatgatcggtgggcccatcctcccctcagaacgaccaggtcatgct
ctcattgaacagtggaacccagttggtcttgttggcgtcatcacagcctttaatttcccc
gtggctgtttatggatggaacaacgcccttgcgctcacctgtggcaatgtgtgcctctgg
aaaggtgctccgactacacctcttacaagtgtcgcagtcactaagattgtagctgaggtg
ctggaagcaaacaacctaccaggtgccatctgctccatgacctgtggaggagcagatatt
ggtacagccatggcgaaggacgaacgcgtggatttgctgtctttcactggtagtacccat
gttggcaagatggtgggcatgatggtgcaggagcggtttgggcgcaaactactggagctc
ggcggaaacaatgctattattgtgtttgaggatgcagatctaaaccttgtggtgccctct
gctgtctttgcgtcagtgggtacagctgggcagcgctgtaccaccaccaggaggctgatt
ctacatgagagcgttcatgacacagtggtggaaagggtcgccaaggcctacaaacaagtc
cgcattggagatccctgggatcccagcaccctctatgggcccctccacaccaaacaagct
gttgagcagtaccagtcggccattgagcaagccaaacaacaaggtggtacagtggtgtgt
ggtggaaagaagatggaccgacctggaaactacgtggagcccactatcattactgggctg
gctcatgacgcacccattgtccacacagagacattcgtccccatcctgtatgtcctcaag
ttcaagactgaagaggaagcattcgccttgaataatgaggtgaagcagggtctttccagc
agcatcttcaccaaagacatgggccgggttttccgttggctcggacccaaaggatccgac
tgcggcattgtaaatgtcaacattcccacaagtggagctgaaattggaggagccttcggt
ggagaaaaacacacaggaggtggaagagagtccggcagtgactcatggaagcagtacatg
aggcgttcaacgtgcacaatcaactacagcaaggatcttcctctggctcagggaatcaag
tttgagtga

DBGET integrated database retrieval system