KEGG   Cynoglossus semilaevis (tongue sole): 103393066Help
Entry
103393066         CDS       T04866                                 

Gene name
gaa
Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00052  Galactose metabolism
csem00500  Starch and sucrose metabolism
csem01100  Metabolic pathways
csem04142  Lysosome
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103393066 (gaa)
   00500 Starch and sucrose metabolism
    103393066 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    103393066 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103393066 (gaa)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103393066 (gaa)
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103393066 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 103393066
NCBI-ProteinID: XP_008328113
LinkDB All DBs
Position
17
AA seq 928 aa AA seqDB search
MGHRSNYSASVVIILSFLISFYIIHLLDQHFTLVRSNYTKNNPVFIYERLSGQNLIDIRE
NNPVNSKDSNIYRHQKCSLEPEYRFDCGRDRVLGQSQCEDRGCCYDPLSNSAGPPWCFYP
TFYPGYKMGPLTPTERGRAAVLTRSKPFYLPRDISTLRLEIEERTAGVLHLTLKDPSVQR
YEVELPDDVTQSRDKKDVLYITEFKSDPFGFIVRRKSNGNVIVNTTVAPLLFADQYLQLS
TTLASTLVSGLGEHYTSLLLDLNWTSLTLWNRDMAPHADANLYGSHPFYLVQEGDGSAHG
VFLLNSNAIEVVLQPTPALTWVSTGGILDLYIILGADPQSVVQQYLQVIGFPMMPPYWSL
GFHLCRWGYTTTNTTRYVAQRMHDAGFPLDVQWNDLDYADKRRIFTFDPQRFGDLPEMVE
EFHQRGLKYILILDPGISSTSRPGTYPPFDDGLKRDVFIKNVTGDILIGKVWPGPTAFPD
FTNPEAIQWWEDCIRNFYSKVPVDGLWIDMNEPSSFVQGSVEGCPDTGLENPPYTPRVIG
GQLNSGTLCMSAQQKQSTHYNLHNMYGLTEAFATNRALMKITGKRPFVLSRSSFSGIGRF
SAVWTGDVRSDWEQLRFSIPAVLQFGLFGVPLVGADICGFGGDTTEELCVRWMQLGAFYP
FMRNHNDRPNAPQEPYVFGREAQAAMRSVLKVRYSLLPFLYTLFHHAHTSADTVARPLFM
VFPTDPDCQTIDRQFLWGTSLLISPVLEQGAAQLNAYLPKGTWYNFYNGEPFYSKGQYVL
LPAPLDTINVHVREGHIIPQQEPALTTTASRRNPFFLMVALSSGGQAWGDLFWDDGESLD
TYETRNYCHVTFAAGQSQIVSDPLKLNKALDGLVLGGLRVFGVPSAPHCVLANRVKVRNF
TYRSDTKVLTVSNLTLPMSRAFTVQWIL
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgggacacaggtcaaactactcagcatcagttgtcatcatactttcttttttaatctct
ttttacatcattcacttattagaccaacatttcactctggtcaggtcgaactataccaag
aacaatcccgtcttcatctatgaaaggctttctggacaaaatctaattgatatcagagaa
aataatccagtgaattccaaagacagtaacatttacagacatcagaaatgcagcttggag
ccagaatatcgatttgactgtggcagagatagagttcttggccaaagccagtgtgaggat
agaggttgctgttatgatcctctgtccaactctgccggaccaccgtggtgcttctatccc
actttttatcctgggtacaaaatggggccactcactcctacagagcgaggtcgggctgca
gtcctgacccgctccaagccgttctatctccccagagacatttctactcttagactagaa
attgaagagaggaccgctggtgtgttgcacctcactctgaaagacccttctgtgcagcga
tatgaggtcgaactccctgatgatgttactcagagcagagataagaaggacgtcctctac
atcactgagtttaagtctgatccatttggtttcatagtgcgacgcaaatccaacggaaat
gtgatcgtgaacaccactgtggctcctctgctgtttgctgatcagtacctgcagctgtcc
accactctggcctctactctggtgtctggccttggggaacactacacctccctgctcttg
gaccttaactggacttcacttactttgtggaacagagacatggcacctcatgctgatgct
aacctctacggctcccatccattctacttagttcaggaaggagacgggtcagcacatgga
gttttcctgctcaacagcaatgcaattgaggtggtacttcagccgacccctgctctcacc
tgggtctccactggaggaattctggacctgtatatcattctaggtgccgacccccagagt
gttgtacaacagtaccttcaggtcattggttttcccatgatgccaccttattggtcacta
ggattccacctgtgtcgctggggttacacgaccaccaacacaacccgctatgtagcgcag
cgcatgcacgatgcaggctttcccttggatgtacagtggaacgacctggattatgcagac
aagcgcaggattttcacctttgacccccagcgatttggtgacctcccggagatggtggaa
gagttccatcaaagaggcctgaagtacatcctgattctggaccctgggatcagcagcacc
agtcgtcctggtacttaccctccttttgatgatggcctcaaacgagacgtctttattaaa
aatgtaactggagacattctgattgggaaggtttggcctggaccaacagccttccctgat
ttcaccaacccagaggctatacagtggtgggaagactgcatcaggaatttttattccaaa
gtgccggtggatggactgtggattgatatgaatgaaccatccagctttgtccagggctca
gtggagggctgtcctgacacaggtcttgagaacccaccgtatacacctagagtaatcgga
ggtcagctgaactcagggactctctgcatgtcagctcagcagaagcagtcaactcactac
aacctgcacaatatgtatggactgacagaagcgtttgccaccaacagagctctgatgaag
attacagggaagaggcccttcgttctgtcccgctcctctttctccggcatcggacgtttc
tctgctgtgtggaccggtgatgtcaggagtgactgggagcagctccggttctccatccct
gctgtgctgcagttcggcctgttcggtgtgcctctggtcggggcagacatctgtggcttt
ggaggcgacacgactgaagagctgtgtgtgcgatggatgcagcttggagccttttaccca
tttatgaggaaccacaatgacaggcctaatgctcctcaggagccgtacgtttttgggcgt
gaggctcaggctgccatgcgtagtgtgttgaaagttcgttactccctcctcccctttctc
tacaccctctttcatcacgcacacacctctgcggacactgtggcccggcctctcttcatg
gtatttcccacagaccctgactgtcagactatagaccggcaattcttgtgggggacctca
cttctaattagcccagtattagagcaaggggctgcacagttgaatgcttacctgcccaaa
ggtacttggtacaacttttataacggtgaacccttctacagtaagggtcagtatgtactt
ctacctgctcctctggacactattaatgtacatgtgagagagggacacattattcctcag
caggaacctgccttaacaaccacagcctcacgcagaaaccctttcttcctgatggtggca
ctatcatcaggcggtcaggcctggggcgatctgttttgggatgatggggagagtcttgac
acctacgaaacaagaaattactgtcacgtcacttttgcagctggacagtctcagattgtg
agtgatcctctgaagctgaacaaggccctggatgggctggtgctgggggggctacgagtg
tttggggtgccttctgctccacactgtgttttggccaatagggttaaagtcaggaatttc
acgtaccgaagtgacaccaaggttttgacagtaagcaacctaaccctacccatgtcaaga
gcttttacagtccaatggattctctga

DBGET integrated database retrieval system