KEGG   Cynoglossus semilaevis (tongue sole): 103393170
Entry
103393170         CDS       T04866                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04217  Necroptosis
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103393170 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103393170 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103393170 (stat3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103393170 (stat3)
Transcription factors [BR:csem03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    103393170 (stat3)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 PRKCSH-like Syntaxin-6_N
Other DBs
NCBI-GeneID: 103393170
NCBI-ProteinID: XP_008328255
UniProt: A0A3P8WMU8
LinkDB
Position
17
AA seq 783 aa
MAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAYAANKESHATLVFHNL
LGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIVARCLWEEQRLLQSAT
TAGQDGQAAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLENLQDDFDFNYKTLKS
QGELSQDLNGNSQAAATRQKMAQLEQMLSALDQLRRQIVTEMGGLLTAMDYVQKNLTDDE
LADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKLEELQQKVSYKGDPII
QHRPALEEKIVDLFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTNKVRLLVKFPELN
YQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCG
NGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILW
YNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQLTTLAEKLLGPCVNY
SGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILS
PKPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNSMSFADIIMGYKI
MDATNILVSPLVYLYPDIPKEDAFGKYCRPEAAPEPEMGDSTSTIQPYLKTKFICVTPCP
SVFMDLPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAEANPGHLESLTLDMDVT
SPM
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggcacagtggaatcagttgcaacagctggaaaccaggtatctagagcagctgtaccat
ctgtacagcgacagctttcccatggagctgcggcaatttcttgcaccctggattgaaagc
caagactgggcctatgctgccaacaaggagtctcatgctacactggtgttccataacctc
ctgggagagatagatcagcagtacagccgtttcctgcaggagaacaacgttctctaccag
cataacctacgcaggatcaaacagcatctgcagagcaagtacctggagaagccgatggag
atcgcccgcatcgtcgcccgctgtttatgggaagagcagcggctcttgcagagcgctacg
actgccggacaggatggacaggcagctcatcccactggaacagtggtaacagagaagcag
cagatcctggagcacaacctgcaagatatcagaaagcgagtgcaggacatggaacagaag
atgaaaatgcttgagaacttgcaggatgactttgactttaattataagactctgaaaagc
caaggagagttgtcccaggatctgaacggtaacagtcaggcagccgcaacaagacagaag
atggctcagcttgaacagatgctgagcgccttggaccagctgaggaggcaaatcgtgaca
gagatgggtggcctgctgacagccatggattatgtgcagaagaacttgacagacgatgaa
ctggcagactggaagaggagacagcagattgcctgtattggaggtccgcccaacatctgc
ctggatcgcctcgaaacatggatcacgtcgttggccgagtcccagctccagattcgtcag
cagataaagaaactggaggagctccagcagaaagtgtcctacaaaggagacccaatcata
caacaccgacctgctttggaggagaagattgtggatttgttcagaaacctgatgaagagt
gcttttgtggtagaaagacagccgtgtatgccaatgcacccagaccgacctctggtcatc
aaaacaggtgttcagtttactaataaagtcaggttactagtcaaatttccagaacttaat
taccagctgaaaataaaagtttgcatcgacaaagaatccggcgatgtggctgcaattcga
ggatcacgaaaattcaatattcttggcaccaacaccaaagtaatgaacatggaggaatcc
aacaacggcagcctgtcagcagagtttaaacacttgaccttgagagagcagaggtgtggt
aatggcggccggaccaatagtgatgcctcactgatcgtcacagaggagctccatctcatc
acttttgagacagaggtttatcaccaaggtctgaagatagatctggagactcattctctg
cccgttgtcgtcatttcaaatatttgccaaatgcccaacgcctgggcttccattctgtgg
tacaacatgctcactaaccaccctaagaatgtaaacttcttcaccaaacctccagtggga
acgtgggaccaggtggccgaggtgctcagctggcagttctcctctaccaccaagagaggc
ctgaccattgaacagctcaccacgctggctgagaaattacttggtccctgtgtcaactac
tctggctgtcagataacctgggccaagttctgcaaagaaaacatggccggtaagggcttc
tccttctgggtgtggctggacaacatcattgacctggtgaagaagtatatcctggcgctg
tggaacgagggttacatcatgggatttatcagcaaggagagggagagagccattctgagt
ccgaaacctcctggcaccttcctgctgcgcttcagtgagagcagcaaggaggggggcatc
acatttacatgggtagagaaagacatcagtggaaaaactcagatccagtctgtggagccg
tacaccaagcagcagctcaacagcatgtcgtttgccgacatcattatgggctacaagatc
atggacgccaccaacatcctggtctcacccctggtctacctttaccctgatattcccaaa
gaagatgcttttggaaagtactgcaggccagaggctgcacctgaaccggagatgggcgac
tccacgagcaccattcaaccgtacttgaagacaaagttcatctgtgttacaccgtgtccc
tccgtgttcatggacttgccggacagtgagctgcttgggaacggattcccaggcacaaat
tccggaaacaccagtgacctcttccctatgtctcctcgtactctggactccctgatgcac
aacgaagctgaggctaatcctggacatttggaatcgttgactttggacatggacgtgact
tcacccatgtga

DBGET integrated database retrieval system