KEGG   Cynoglossus semilaevis (tongue sole): 103393219
Entry
103393219         CDS       T04866                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04350  TGF-beta signaling pathway
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04540  Gap junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103393219
   04012 ErbB signaling pathway
    103393219
   04350 TGF-beta signaling pathway
    103393219
   04370 VEGF signaling pathway
    103393219
   04371 Apelin signaling pathway
    103393219
   04068 FoxO signaling pathway
    103393219
   04150 mTOR signaling pathway
    103393219
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103393219
  09143 Cell growth and death
   04114 Oocyte meiosis
    103393219
   04210 Apoptosis
    103393219
   04218 Cellular senescence
    103393219
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103393219
   04520 Adherens junction
    103393219
   04540 Gap junction
    103393219
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103393219
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103393219
   04621 NOD-like receptor signaling pathway
    103393219
   04625 C-type lectin receptor signaling pathway
    103393219
  09152 Endocrine system
   04910 Insulin signaling pathway
    103393219
   04912 GnRH signaling pathway
    103393219
   04914 Progesterone-mediated oocyte maturation
    103393219
   04916 Melanogenesis
    103393219
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103393219
   04270 Vascular smooth muscle contraction
    103393219
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103393219
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103393219
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103393219
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103393219
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103393219
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103393219
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103393219
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103393219
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH YukC Choline_kinase FTA2
Other DBs
NCBI-GeneID: 103393219
NCBI-ProteinID: XP_008328321
UniProt: A0A3P8WLI9
LinkDB
Position
17
AA seq 386 aa
MADSSSSAAVGGAGSNSAAAAGVEGAPGAAGTKAGSESVKGQIFDVGPRYTNLSYIGEGA
YGMVCSAMDNVTSQRVAIKKISPFEHQTYCQRTLREIKILLRFNHENIIGINDILRARHI
DNMRDVYIVQTLMETDLYKLLKSQRLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNL
LINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIWSVG
CILAEMLSNKPIFPGKHYLDQLNHILSVLGSPCQEDLNCIINTKARNYLQSLPPKAKVPW
ETLFFKSDPKALDLLGRMLTFNPIKRISVEEALAHPYLEQYYDPTDEPVAEEPFTFSMEL
DDLPKERLKELIFEETARFQHTYQGS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atggcggattcgagcagctccgcagcagtcgggggcgcaggctccaacagcgctgccgct
gctggggtggagggagctcctggagctgcgggaaccaaggccgggtccgagtcagtcaag
ggccagatatttgacgtaggcccccgctatacaaatctgtcttacatcggggaaggggcg
tacggaatggtgtgctctgccatggacaacgtgaccagccagcgtgtggcaatcaagaag
atcagcccctttgagcaccagacgtactgccaacgcacactgagggagatcaagatcctg
ctgcgtttcaaccatgagaacatcatcggcatcaacgacatcctcagggcacggcatatt
gacaacatgagagatgtctacatcgtgcagaccctgatggagacggacctgtacaagctg
ctgaagagccagaggctgagcaacgaccacgtctgctacttcctgtaccagatcctgcga
ggcctcaagtacatccactctgccaacgtgttgcaccgtgacctcaaaccctccaacctg
ctcatcaacaccacctgtgacctcaagatctgcgactttggcctggcacggatagccgac
cctgagcatgaccacacaggtttcttgacagagtatgtagccactcgttggtacagggct
ccagaaatcatgctcaactcaaagggctactccaagtctattgacatctggtcagtgggc
tgcatcctggctgagatgttgtccaacaagcccatctttcctgggaaacattacttggac
caactgaaccacatactgagtgtcctcggctctccatgtcaagaagatctgaactgcatc
atcaacacaaaggccaggaactatctgcagtccctgcctccaaaagccaaggtcccctgg
gaaaccctcttcttcaagtcagatcccaaagccttagacctgctgggtcgcatgctgacc
tttaaccccatcaagcgaatcagtgttgaggaggctctggctcatccgtacctggaacag
tactacgaccccacggatgagcctgtagcagaggaacccttcactttctccatggagctt
gacgaccttcccaaggagaggctgaaggaactgatctttgaggaaacagctcgtttccag
cacacttaccagggttcctga

KEGG   Cynoglossus semilaevis (tongue sole): 103397828
Entry
103397828         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04261  Adrenergic signaling in cardiomyocytes
csem04270  Vascular smooth muscle contraction
csem04350  TGF-beta signaling pathway
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04520  Adherens junction
csem04540  Gap junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103397828
   04012 ErbB signaling pathway
    103397828
   04350 TGF-beta signaling pathway
    103397828
   04370 VEGF signaling pathway
    103397828
   04371 Apelin signaling pathway
    103397828
   04068 FoxO signaling pathway
    103397828
   04150 mTOR signaling pathway
    103397828
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103397828
  09143 Cell growth and death
   04114 Oocyte meiosis
    103397828
   04210 Apoptosis
    103397828
   04218 Cellular senescence
    103397828
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103397828
   04520 Adherens junction
    103397828
   04540 Gap junction
    103397828
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103397828
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103397828
   04621 NOD-like receptor signaling pathway
    103397828
   04625 C-type lectin receptor signaling pathway
    103397828
  09152 Endocrine system
   04910 Insulin signaling pathway
    103397828
   04912 GnRH signaling pathway
    103397828
   04914 Progesterone-mediated oocyte maturation
    103397828
   04916 Melanogenesis
    103397828
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103397828
   04270 Vascular smooth muscle contraction
    103397828
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103397828
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103397828
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103397828
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103397828
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103397828
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103397828
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103397828
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103397828
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 103397828
NCBI-ProteinID: XP_008334445
LinkDB
Position
Z
AA seq 369 aa
MATAAVPAPAGCGPSPGPGTEXLRGQAFDVGPRYSSLTYIGEGAYGMVCSAYDRDNKIRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPVRCKVPWNRLFPNADPKALDLLD
KMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPVAEVPFKFEMELDDLPKETLKDLIFQET
AHFQPGFRS
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgccgtgcctgcccctgctggctgcgggcccagccccgggccgggaacg
gagncgctccgcgggcaggccttcgacgtcgggcctcggtacagcagccttacctacatc
ggtgagggagcctacggaatggtctgttctgcttatgaccgggacaacaagatccgcgtg
gccatcaagaagatcagcccttttgaacatcaaacatactgtcagcgcaccctgagagag
atcaagatcctcctgcgcttcaaacacgagaacatcatcggcatcaatgacatcattcgc
acaccaaccattgaccagatgaaggacgtatacattgtccaggatctcatggagaccgac
ctgtacaagctcctcaagactcaacacttgagcaatgaccacatctgctatttcctctac
caaatcctacgagggctcaagtacatccactctgccaacgtcctgcaccgtgacctgaaa
ccttctaaccttctgctcaacaccacctgtgatctgaagatctgcgattttggtttggcc
cgtgttgctgatcccgaccatgaccacactgggttcctcacagagtacgtggccacacgt
tggtaccgtgcacctgagattatgctcaactcaaagggctacaccaaatccatagacatt
tggtcagtgggctgcatcctggctgagatgttgtccaacagaccaatctttcctggaaaa
cactacctggatcaacttaaccacattttggggatccttggttctccttctcaggaggat
ttgaactgcattatcaacattaaggccaggaactaccttttgtcacttcctgtgcgctgc
aaagtgccatggaaccgcctcttccccaatgctgatccaaaagctctggacctgttggac
aagatgctcaccttcaacccccacaagaggatcgaggtggaggaggctctggcccatcct
tacctggagcagtactacgaccccacagatgagccggtggctgaggtgccattcaagttt
gagatggaactggatgatctgcccaaagagacattgaaggatctcatctttcaagagaca
gcacatttccagcctggctttaggtcttaa

DBGET integrated database retrieval system