KEGG   Cynoglossus semilaevis (tongue sole): 103393796
Entry
103393796         CDS       T04866                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04141  Protein processing in endoplasmic reticulum
csem04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103393796 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103393796 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103393796 (atf6b)
Transcription factors [BR:csem03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103393796 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf CENP-H GAS DUF4140
Other DBs
NCBI-GeneID: 103393796
NCBI-ProteinID: XP_016896659
LinkDB
Position
18
AA seq 707 aa
MSTELLTELENRFFADNLLTNEDWDACLFQCENMEEGEDADFSRGLKYDTSFVSNLVLTL
DPDDPSSPWQHCEDNLLTGDSPVIKHEMGIAQPLPEEMLFQVKAEPLSPASSLGSDSSVG
SPDPQVTVKGETPPTPPYMYGDILSPPLGSMEVTVATSVVARPQTQLQTPLTAQIPAVIT
GLQTQSTVLPRSTLVNTKPPIQPRPVCVASLPVAQTPAPTKTLILQGLPTMDQNRPARVW
HSHVLSQSVCLSSAPAIVKVEPVSSNICSSPAPPAPPAPPPPSRKRFVPATSSLPGNNAA
DIDMKVLKRQQRMIKNRESACQSRKKKKEYLQNLEAQLREAQQENHRLRRENQALRERLA
GEEGGDSASNKRAVCVMAVLLFMTFSFGPVSITDRKLAAAPQDGSVVWYTGRQLLEIEQQ
PPSPRRRPTTRLEMEEDGGAAEVEGFSAESYQFRNLSDVFSDVKELVLQDIDRYFTSSDC
RQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKIVKKAKIAQKAQLRKTNFSRYLPVQM
HRSIENQLQVLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLV
MPAMSMNESLYNAPQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPPPPPPSSSSAHNH
HHNNHTSLRGRHHHHPQHQRSAAAAASSSSPQPRSAAKYLISQSEDV
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgagcacggagctgctgaccgagctggagaaccgattcttcgctgacaacctgctcacc
aacgaggactgggatgcctgcctgttccagtgtgagaacatggaggagggcgaggacgca
gatttcagccgggggctgaaatacgacacgtcgtttgtcagtaacctggtcctcaccctg
gatcctgacgacccctcgtcaccatggcaacactgtgaggacaacctgctgacaggagat
tctccggtcatcaaacatgagatgggcatcgctcagccgctgcctgaggaaatgttgttc
caggtgaaggcggagcctctctctccggcgtcctccctcggatcagactcttccgtgggg
tcaccagatccacaggtcacggtcaaaggtgaaaccccgcccactcctccttatatgtac
ggtgacatcctgtctccgcccctcggctccatggaggtcaccgtggccaccagcgttgtg
gcccggccacagacgcagctacagacgccactgaccgcccagattccagcggtcatcact
gggttacagacacagagcacagtactgcccaggtccactctggtcaacaccaaacctccc
atccagcccagaccagtctgtgtggcctccttacctgtggcccagactccggcccccacc
aagaccctcatcctacagggcctccccaccatggaccagaacagaccagcacgcgtgtgg
cactcgcatgtcctctctcagtcagtctgtctcagctcagctccggccatcgtcaaagtg
gagcccgtttcttcaaacatctgctccagtcctgctcctcctgctcctcctgctcctcct
cctccctccaggaagaggttcgtccctgccacctcctcactgcctgggaacaacgccgcc
gacattgacatgaaggtgttgaagcgtcagcagaggatgatcaagaaccgggagtcggcc
tgtcagtccaggaagaagaagaaggagtacctgcagaacctggaggctcagctgagggag
gcgcagcaggagaaccacaggctccgcagggagaaccaggctctgagggagagactggct
ggggaagaggggggagactcagctagtaataaacgagcggtgtgtgtcatggccgtcctg
ctcttcatgaccttcagctttggtccagtcagcatcacagacaggaagttagccgcagcg
ccgcaggacggcagcgtggtgtggtacacgggtcgacagctgctggagatcgaacagcag
ccgccatcgccgcggcgacgaccaacgaccagactggagatggaggaggacggaggagcg
gcagaggtggagggattttctgccgagtcttaccagttcaggaacctgagcgacgtcttc
agtgacgtgaaggagctggtcctccaggacatcgatcggtacttcacctcctcagactgt
cgacagttcaaccgctccgagtctctgaggctggcagacgagctccgaggctgggttcac
aggcaccagatcgacaggaagaagtctggagggaaaccaaagatcgtcaagaaggccaag
atcgctcagaaggctcagctgaggaagaccaacttctccagatacctgcccgttcagatg
catcgctccatcgaaaatcagctacaggtacttcctggtcctgaggtcacgtacagcgac
ttcctggacgccatcgaccgacgagaggacacgttctacgtcgtctctttcagacgggac
cacctgctcctccctgccatcagccacaataaaaccagtcgacccaaaatgtcgctggtg
atgcctgcgatgtcgatgaacgagagtctatacaacgccccccaggggtacgagatgatg
atgcaggtggactgcgaggtcatggacactcgcatcgtccccatcaagtcctccgctgtg
ccgccgtctctgcgcgaccctcctccgcctcctccgtcctcgtcctccgctcacaaccat
caccataacaaccacacgtccctgcgtggacgccaccatcaccaccctcagcatcagcgc
tccgccgccgccgccgcctcctcgtcctcccctcagcccaggtccgcagctaagtatcta
atcagccaatcagaggacgtctga

DBGET integrated database retrieval system