KEGG   Cynoglossus semilaevis (tongue sole): 103394036Help
Entry
103394036         CDS       T04866                                 

Definition
(RefSeq) alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00730  Thiamine metabolism
csem00790  Folate biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    103394036
   00790 Folate biosynthesis
    103394036
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103394036
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csem00537]
    103394036
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     103394036
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103394036
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:csem00537]
 Enzymes
  103394036
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Fis1_TPR_C
Motif
Other DBs
NCBI-GeneID: 103394036
NCBI-ProteinID: XP_008329396
LinkDB All DBs
Position
2
AA seq 542 aa AA seqDB search
MQTPPRWAPNLLLILLSPVLLAVGGAAVESQAALRELEKDPSFWDAQARATLDAALKLHP
RNHQAKNIILFLGDGMGVSTVSAARILRGQMEGGSGEETVLAMDAFPYVALSKTYSVDRQ
VADSASTATAYHCGVKANAKTLGVSAKAVAYECNTTFGNEVYSVLRRAKAQGKSVGIVTT
TRVQHASPAAAYAHSVSRSWYSDTHLPHSAREQGCVDIATQLVTNVDIDVILGGGRMYMT
PKGTPDPEYPTSKSCKGDRRDERNLIDVWLKAQPAKKSQYVWHRKEFDEIDVETTDRLMG
LFEPKDMKFEVFRNSTRDPSIVEMTEKAIQILSKNPKGYFLFVEGGRIDHGHHDGIAKLA
LSEAVMFDQAIQRAARITKESETLTVVTADHSHVFTFGGNTPRGNPIFGLAPKKADDRMP
FTSILYANGPGYVHVNGTRENITMVDYFDEEYMQQAAVPLDTETHGGEDVAIYAKGPMSY
LFHGVKEQNYVAHVMAYAACLKPYTNCPPHPHHNHHRRNSADAVNTHPCFLFVTLSLLWL
LK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgccaccgcgctgggcccccaacctcctgctcatcctcctgagccctgtcctg
cttgctgttggaggggccgcggtggagagccaagcagcgctgcgtgaactggaaaaggat
ccatctttttgggatgctcaggcgagagctacactggatgctgcgctcaaactccaccct
cggaaccaccaagccaagaacatcatcctgttcctcggagatgggatgggtgtgtccact
gtgtcagcagctcgaatcctgcggggtcagatggagggtggatcaggggaggagacggtt
ctggccatggacgccttcccttatgtggctctgtctaagacctacagcgtggacaggcag
gtggcagacagcgctagcacagctacagcttatcactgcggggtcaaggccaacgctaag
acgctcggagtcagcgctaaggcggtggcctacgagtgtaacaccacctttggtaacgag
gtctactcggtgttacgacgtgccaaggcacaaggtaaatccgttggtatagtgacaacc
actcgggtccagcacgcctccccggctgctgcctacgctcactccgtcagccgcagctgg
tacagtgacacgcacctcccccacagcgcccgtgagcagggctgtgtcgacatcgccacc
cagttggtcaccaacgttgacattgatgtgatcctcgggggaggaaggatgtacatgaca
ccaaaaggaactccagatccagaatatcctacctccaagtcgtgcaagggcgatcgtaga
gacgagaggaacctgattgacgtgtggctgaaggctcaaccggctaaaaagtcacagtac
gtctggcacaggaaggagtttgacgagatcgatgtcgaaactactgatcgactcatgggt
ctgtttgagccaaaagacatgaaatttgaggttttccggaacagcacacgagacccctcg
attgtggagatgacggaaaaagccatacaaatcctcagcaagaaccccaaaggatacttc
ttgtttgtagaaggtgggagaatcgatcacggtcatcacgacggcatcgccaaactggct
ctgtctgaagcggtgatgttcgaccaggccattcagcgagcagcacggattaccaaggaa
tcagaaacactgacggtggtcactgcagatcattctcacgtgtttacctttggaggaaac
acaccacgagggaatccaatttttggtttggcaccaaagaaagctgacgacagaatgccc
ttcaccagcatcctctacgccaatggccccggctacgtccatgtaaatggaaccagagaa
aacatcacgatggtggattactttgacgaggagtacatgcagcaggcggccgtcccgttg
gacacggagactcatggcggagaagacgttgccatctatgccaaaggccccatgtcttac
ctgttccatggggtaaaagagcaaaactatgtggctcatgtcatggcctacgctgcctgt
ctgaagccttacacaaactgtcccccgcatccacaccacaaccaccatcgacgaaattca
gctgacgctgtcaacactcacccctgcttcctgtttgtcacactcagcctcctctggctg
ttgaaatga

DBGET integrated database retrieval system