KEGG   Cynoglossus semilaevis (tongue sole): 103394206Help
Entry
103394206         CDS       T04866                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 3A-like
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103394206
Ion channels [BR:csem04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   103394206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF569 DUF3592
Motif
Other DBs
NCBI-GeneID: 103394206
NCBI-ProteinID: XP_016886707
UniProt: A0A3P8WCK9
LinkDB All DBs
Position
2
AA seq 461 aa AA seqDB search
MFFPLDLGSAFNCSSPTPAALFDALDKELFSKNLIRPVQDFSRPLNVSIMITVVGIVGVD
EKSQTLTTVIWQVLQWDIEGLSWDDKECGSNRVSVPRENLWIPDIHILEIMEEDQSPKTP
YAYLFNTGRVYDDQPMRVVSACQLKIYTFPFDIQNCSLTFGPYLHFAADVRMVEGTTAEK
ILQESTEVLHSSGEWEFVHISVSHSSLEFDEGKYSAIKYFIILRRRPQLYVMNLLIPSCF
LITVDLFSFLLPPQSVDRSSFKMTLILGYTVFLLIINDLLPITGETPLINIFFSISLILM
VVSLLETVLITHIQFSSSQYSEVPQWLSVLVLRYLAIVVFIPPIERSNRVTVFFNPSARA
HAMNDSISKISNRDLQTVCSHTTSDKASVDLALDELKRLSGELMAIRLQVDKHFQSSNTS
EEWRMMGEVIDRLLFGLYVIFISISFIITVAIWTWNSSYTA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcccgttagacctgggctcagcgttcaactgcagcagcccgactcccgcagcc
ttgttcgatgccctggacaaagaactcttctccaaaaacctcatccgtcccgtgcaggac
ttttcacgtccactgaacgtctccatcatgatcaccgtggtgggaatcgtgggcgtggat
gaaaagtcccaaacgctgactacagtcatctggcaagttctgcagtgggacatcgagggt
ctcagctgggacgacaaggaatgtggaagcaaccgagtctctgttcctcgagaaaatctc
tggatcccagacatccatattttagagatcatggaggaagatcaatctcccaaaactccg
tacgcctacttgttcaacaccggccgtgtctatgacgaccagcccatgagggtggtcagc
gcctgccagctgaaaatctacacttttccgttcgatatccagaactgctccttgaccttt
ggcccataccttcactttgctgcagatgtgaggatggttgaaggcaccacagctgagaag
atcctgcaggagtccacagaggttcttcacagcagcggagagtgggagtttgtgcacatc
agtgtgtctcactcctccctagagtttgacgagggcaaatattctgcaatcaagtacttt
ataattttaagacgtcgaccgcagctgtacgtgatgaacctgctgatccccagctgcttc
ctcatcaccgtcgacctcttcagcttcctgctgcctccacagagcgtggaccggtcgtcc
ttcaagatgaccctcatcctgggctacaccgtcttcctgctcatcattaacgatctgctg
cccatcactggggaaacgccgctaatcaatattttcttctccatcagtctcatactgatg
gtggtcagcctgttggagacggtgctcatcacccacatccagttcagcagcagtcagtac
agtgaggtccctcagtggctcagcgtcctggtcttacgatatttagccatcgttgttttc
attcctccgatcgagaggagcaaccgagtcacagtcttcttcaacccatctgcaagagcc
catgctatgaatgacagcatcagtaagatctcgaacagagatcttcagaccgtctgcagc
cacaccacgtcagacaaagcctctgtcgacttggccttagatgaactgaagagactgagc
ggagaactcatggccatccgtctgcaggtggacaaacatttccagagcagcaacacctca
gaggagtggagaatgatgggcgaagtcatcgaccgcctcctgtttggcctctacgtcatc
ttcatctcgatcagcttcatcatcactgtagcaatctggacctggaacagctcttacaca
gcatga

DBGET integrated database retrieval system