KEGG   Cynoglossus semilaevis (tongue sole): 103394639
Entry
103394639         CDS       T04866                                 

Definition
(RefSeq) interleukin-6-like
  KO
K05405  interleukin 6
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04218  Cellular senescence
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04623  Cytosolic DNA-sensing pathway
csem04625  C-type lectin receptor signaling pathway
csem04672  Intestinal immune network for IgA production
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103394639
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103394639
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    103394639
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103394639
   04621 NOD-like receptor signaling pathway
    103394639
   04623 Cytosolic DNA-sensing pathway
    103394639
   04625 C-type lectin receptor signaling pathway
    103394639
   04672 Intestinal immune network for IgA production
    103394639
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103394639
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103394639
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103394639
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Interleukins
   103394639
SSDB
Motif
Pfam: IL6 Defensin_propep partial_CstF
Other DBs
NCBI-GeneID: 103394639
NCBI-ProteinID: XP_008330269
LinkDB
Position
18
AA seq 229 aa
MVSTLKAKFLSTLTLLTALLLCALGAPVETEVTDILAGDSSGEEEDVVTHGLLSASPFWG
LILGATARHQKEFEEEFKSEMTYYYLDNYRFPAIPAGCPTSNFSKEACLKRLAEGLNTYM
VLLMYVEQEYPNNAIVMEIKPYNIRLINLIKEKMKNPRLVTNMTSSQQEKLLSDLNNPIP
FERKMTAHCILRQFHNFLRDGIVAVRKRERGRTSRVMKPNLHFFTALKN
NT seq 690 nt   +upstreamnt  +downstreamnt
atggtctcaaccctcaaagccaagtttctgtcaacgctgacgctgctgacagccctgctg
ctgtgtgccctcggagcgccagtggaaactgaggtgaccgacattctggcaggtgactct
tcaggtgaggaggaggatgtagtgacccatggactcttgagtgcgtctccattttggggc
ttgattctcggcgcaactgctcgtcaccagaaagagtttgaagaggaattcaagagtgaa
atgacatattactatctggacaactacagattccccgcaattccagcaggctgccctaca
tccaactttagcaaggaggcatgtctcaagaggttggccgaaggtctgaacacctacatg
gttcttttaatgtatgtggagcaggagtatcccaacaacgccattgtgatggagatcaaa
ccctacaacattaggctaatcaacctcatcaaagaaaagatgaagaaccccagactggtc
accaacatgaccagcagccagcaggagaaactgctgagtgacctcaacaacccgatccct
ttcgaaagaaagatgacagcgcactgcatcctgcggcagttccacaacttcctgcgtgat
ggcatagtggcagttcgcaaacgagagagggggcggaccagtcgcgtcatgaaacctaac
cttcacttttttacagcactgaagaattaa

DBGET integrated database retrieval system