KEGG   Cynoglossus semilaevis (tongue sole): 103394805Help
Entry
103394805         CDS       T04866                                 

Gene name
tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csem01002]
    103394805 (tmprss2)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     103394805 (tmprss2)
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103394805 (tmprss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 SRCR Ldl_recept_a Trypsin_2
Motif
Other DBs
NCBI-GeneID: 103394805
NCBI-ProteinID: XP_008330469
LinkDB All DBs
Position
19
AA seq 480 aa AA seqDB search
MNNNQENGLTYDNRGFQHDDGRPPPYNPQAQIYPSLPAHSQNCGAATSEPINTHQTATPV
LAVSTVQSKGKKKCSTNRIICVTLCVLLLLAVVGVLLWYFLYYQCLLGKSCRTGGKCLSS
SQWCDGVRDCSNGEDEAQCFRLQGVNSILESYSTRKNTWLPVCADDWDNDYGRTVCGQMG
YMRQDYVEYTQISTSSSKGYMKLKPGSIHDSRIQSQLTYSPTCSASAIKLICIQCGRSTA
APSSRIVGGTEAVNGAWPWQVSLQIQGQHLCGGSIISPYWILSAAHCFQRFYNPQRWRVY
SGDVSLSRMSFGSGKSVEKIINHEKYNTDTNDNDIALLKLSTPLTFSVTVKPVCLPNSGV
DLSPGRQAWITGWGALRSSGPSPDILNQAQVTIYSRDQCNSDWILSGQVTETMICAGKLE
GGVDSCQGDSGGPLVAKEGNLWWLAGDTSWGIGCAWKNKPGVYGNVTHLMDWVYWQMQNE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaatcaggaaaatggcctcacctatgacaacagaggtttccaacatgacgac
ggaaggcctcccccatacaacccacaggcgcaaatatacccttctctcccagcacactcc
cagaactgtggagctgcgacctctgagcctatcaacacccaccaaactgccacacctgta
ctagcagtcagcacggtacagagtaaagggaaaaagaaatgttccacaaaccgcattata
tgtgtgactctgtgcgtgctccttctcctggctgtggtcggggtcttgctgtggtacttc
ttgtactaccagtgtttactggggaagtcttgtagaactggagggaagtgtttgagttcg
tcccagtggtgcgatggcgtcagggattgttcgaatggagaggatgaagcccagtgtttc
cgtcttcagggcgtcaactctatcctggagagttactcaacgagaaaaaacacatggctg
ccagtgtgtgctgatgactgggacaacgactacgggaggacagtctgtgggcagatgggc
tacatgagacaggattatgtggaatacactcaaatcagtacttcatcatccaaaggatac
atgaagctaaagccagggagtattcatgactcacgtatacagtcacagctcacctacagt
cctacttgttctgcaagtgccatcaaactgatttgcatacaatgtggtcggagcacagca
gcccctagttctcgtatcgtcggtggtacggaggcggttaatggagcctggccgtggcag
gtcagccttcagatccagggtcaacacttgtgtggaggttctattatcagcccttactgg
atcctctcagctgcgcactgctttcaaagattctacaacccacagcggtggagagtttac
tctggtgatgtgagcctctcccgcatgagtttcggctctggaaaaagtgttgaaaaaatc
atcaatcatgaaaaatacaacacggataccaatgacaatgacattgccctgctgaagctg
agtacacctttgaccttcagtgtaacggtgaagccagtttgcctcccaaactctggagta
gacctctcgcctggacgtcaagcctggatcacaggatggggagccctgaggtcatctgga
ccttctcctgacatactaaatcaggcccaggtgaccatttacagcagagaccaatgcaac
agtgattggatattgagcggccaagtcactgagaccatgatctgtgcaggcaaactggag
ggtggagtggattcatgtcagggtgacagtgggggacctctggtggccaaggagggaaac
ctatggtggttggcaggggacacaagctgggggattggatgtgcctggaagaacaaacca
ggcgtctatggcaacgtcacccacttaatggattgggtctattggcaaatgcagaatgaa
tga

DBGET integrated database retrieval system