KEGG   Cynoglossus semilaevis (tongue sole): 103394845
Entry
103394845         CDS       T04866                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103394845 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103394845 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:csem03310]
    103394845 (nr3c1)
Transcription factors [BR:csem03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    103394845 (nr3c1)
Nuclear receptors [BR:csem03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   103394845 (nr3c1)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GCR
Other DBs
NCBI-GeneID: 103394845
NCBI-ProteinID: XP_008330515
UniProt: A0A3P8WG92
LinkDB
Position
19
AA seq 770 aa
MDQGGRERNSNRDDSLTFGEVGVRLSSNAGDTTSSLLLSTMHLPGPGSLPHLTVPPNAER
KEQGEYGAIFKSPHPQCEGPHMKEGKIVRMEKQQQQQDVGMFNIKGSEPFLNPNFSDPDQ
TSTCVINTSVSSVHGSLPISDLFPQQIKQEEPFSLERDLGNCSGLTASGPCLLDNSTRLI
EETDIWQALDLPSSLPEISGLELDSEMEHLQNILHHGDVGGPDSSLLKEPKMGNRGNCTS
LNGADQQHPMHHTQHLQSGHLLQHQQHPHHQSSLLLSTVMVKEEEKDQDDFIQIQTPGVV
KLEKKGSSGLCQSQCLLSSMNPLQTGGPLTPTMSMGVGHGYQYKANQPSSLDLPDPYGMY
PNLPQMEESWSRVNKFGEPSGLQRANDGLSSAFIVSFPSPSTRTGEGSSSAVPGPSKLSG
PTHKICLVCSDEASGCHYGVVTCGSCKVFFKRAVEGWRARQNTDGQHNYLCAGRNDCIID
KIRRKNCPACRFRKCLEAGMNLDARKNKRPRPKIIPKMPPLIPPMLSVLKAIEPEIIYSG
YDGTMPDTSSRLMSTLNRLGGQQVISAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFS
LGWRSYEQCNGSMLCFAPDLVINKERMKLPFMSDQCEQMLKICNEFVRLQVSYDEYLCMK
VLLLLSTVPKDGLKSQGVFDEIRMAYIKELGKAIVKREENASQNWQRFYQLTKLLDSMQE
MVEGLLQICFYTFVNKTLSVEFPEMLAEIITNQIPKFKDGSIKPLLFHQK
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggatcagggaggacgggagcgcaacagtaatcgagacgacagcctgacatttggggag
gtgggagtccgactaagtagcaacgctggtgacacaacaagttcactactcctttctaca
atgcacctgcctggccctgggtccttgccacatctcacagttcccccaaatgctgaaagg
aaagagcaaggagagtatggagccatctttaagtctcctcatccacagtgtgaagggcca
cacatgaaggagggcaaaattgtcagaatggagaaacaacagcagcagcaggatgttggt
atgttcaacattaagggcagtgagccatttttgaacccaaatttttctgatcctgatcag
acgtcaacctgtgtaatcaacacatcagtctcctctgtccacggaagcctccccatatct
gatcttttcccacagcaaattaaacaggaggaacctttttctctggaacgtgatttagga
aattgtagtggactcacagccagtggcccatgtcttttggacaacagcactcgactcatt
gaggaaactgacatttggcaagccctcgaccttccgagttcattgccagaaatcagtggt
ttagagttggattcggaaatggaacacttacaaaacatactgcatcatggcgatgtcggt
ggtcctgacagcagcttgctgaaggaacccaaaatgggtaacagggggaactgcaccagc
ttgaatggtgcagaccagcagcaccccatgcaccatactcaacacctgcaatctggccac
ttactgcagcaccagcaacatccacatcaccagagttcattacttctgtctacagttatg
gtcaaagaggaagagaaagatcaggacgacttcatccaaatccaaaccccaggtgtagta
aaactggaaaagaagggcagcagtggattgtgtcagtcacagtgtcttctaagcagtatg
aaccctctacaaaccggaggccctttgacaccaaccatgagtatgggtgttggacatggc
taccagtataaagcaaaccagccctcctcgttggaccttcctgacccttatggcatgtat
ccaaacttacctcaaatggaagagagctggtccagagtgaacaagtttggggagccatct
gggctacaaagggccaatgacgggctctcctcagcttttattgtcagctttcccagcccc
tctacaagaacaggagagggcagcagctctgcagtgccaggaccatctaagctcagtggg
ccgactcacaagatctgtctggtttgttcagatgaagcttctggatgtcactatggggtt
gtgacctgtggaagctgcaaggttttcttcaagagagcagtggaaggatggagagcacga
caaaacacagatggtcagcacaattacctctgtgcggggagaaatgactgcatcattgat
aagatccgcaggaagaattgtccagcctgccgtttcaggaagtgtctcgaagctggaatg
aacttggacgcgaggaaaaataagagaccacgcccgaaaatcatccccaagatgcctccg
ctcataccacccatgctgtctgtgctcaaagccatcgagccagaaatcatctactccggc
tacgacggcaccatgcctgacacctcgtcacgcctcatgtccacactcaacaggttgggt
gggcagcaggtcatttctgcggtcaagtgggccaagtcactaccaggcttccgcaacctg
catttggacgaccagatgacactgctgcagtgctcctggctctttctgatgtccttcagt
cttggatggcggtcatatgagcagtgtaacggcagcatgctgtgcttcgccccagacctg
gtcatcaacaaggagcgtatgaagctgcccttcatgagcgaccaatgcgagcaaatgctg
aaaatctgcaatgagtttgtcaggctgcaagtgtcctacgacgagtatctgtgcatgaag
gtcctgctgctgctcagtacagtccccaaagacggcctaaagagtcagggcgtgttcgat
gagatcaggatggcctacatcaaggagctgggaaaagccatcgtcaagagagaggagaac
gctagtcaaaactggcaacgcttctaccagctgactaagctactggactccatgcaggag
atggtagagggccttctccagatctgtttctacacctttgtgaataaaaccctgagcgtg
gaattcccagagatgttggcggagatcatcaccaaccagataccaaaattcaaggacggg
agcatcaagcctcttctgtttcaccagaaatga

DBGET integrated database retrieval system