KEGG   Cynoglossus semilaevis (tongue sole): 103395214
Entry
103395214         CDS       T04866                                 

Definition
(RefSeq) putative fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103395214
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103395214
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103395214
   00536 Glycosaminoglycan binding proteins [BR:csem00536]
    103395214
Cytokines and growth factors [BR:csem04052]
 Growth factors
  Growth factors (RTK binding)
   103395214
Glycosaminoglycan binding proteins [BR:csem00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   103395214
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103395214
NCBI-ProteinID: XP_008331067
UniProt: A0A3P8VZX5
LinkDB
Position
19
AA seq 149 aa
MSERGFRGLPSLDVSRQQQQHTLTRLYSQNGGYHLRITPDGSVCGGRQENDPYDVLRLKA
VSVGVVVIMGEMTKWFLAMNKSGHLYASQSPNDECFFLEKYEENHYNTYRSQKYNWYVAL
KRNGQPKAGPDTHKGQKAIFFLPRPVGNI
NT seq 450 nt   +upstreamnt  +downstreamnt
atgtctgagagaggtttcagagggctgccgtctctggatgtgtccaggcagcagcaacag
cacacactgaccaggctctacagccagaacggaggctatcacttgaggattacgccagat
ggcagtgtgtgtggtgggaggcaggaaaatgatccttacgacgtcctcagactaaaggca
gtgagtgttggagtggtggtcatcatgggtgaaatgacaaaatggttccttgccatgaac
aaaagtggacatctgtacgcatcacaatcgccgaacgacgagtgcttcttcctggagaag
tatgaagaaaaccactacaacacatatcgctctcaaaagtacaactggtatgtggcactg
aagaggaacggtcaacccaaagctggaccagacacccacaaaggacaaaaggcgatcttc
ttcctgcccaggcctgtaggcaacatctga

DBGET integrated database retrieval system