KEGG   Cynoglossus semilaevis (tongue sole): 103395284Help
Entry
103395284         CDS       T04866                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
csem04370  VEGF signaling pathway
csem04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103395284 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    103395284 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103395284 (ptgs2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103395284 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase Phage_F
Motif
Other DBs
NCBI-GeneID: 103395284
NCBI-ProteinID: XP_008331166
LinkDB All DBs
Position
2
AA seq 607 aa AA seqDB search
MNRQTLSVFLLALGFLVCEGGNPCCSQPCENRGVCTALGSDYECDCTRTGYYGQNCTTPE
LLTLIKVYLKPSPNTVHYLLTHFKGFWNIINSISFLRDAIMKYVLTSRSNMIDSPSTYNS
DYDYKNWEAYSNISYYTRALPPLPEDCPTPMGVVGKKELPDAKVLAEKLLMRREFITDPQ
GTSLMFGFFAQHFTHQFFKSDMKKGPAFTLATGHGVDLSHVYGNDLQKQHKLRLFKDGKL
KHQVLNGEVYPPTVKETGVHMIYPPHIPESQRFAVGHEAFGLVPGLMMYAVIWLREHNRV
CDVLKEVHPDWDDERLFQTTRLILIGETIRIVIEDYVQHLSGYNFKLKFDPELLFKEQFQ
YQNRIASEFNTLYHWHPLMPDTFRVGETHYNYKQFIFNNSVVIEHGINKMVESFTNQISG
RVAGGRNVPVPILYVTVETIEHNRKLRYQSLNAYRKRFNMKPYSSFEDLTGETEMAALLE
EMYGHVDAVEFYPGLLVEKPRPNSIFGETMVEVGAPFSLKGLMGNPICSPEYWKPSTFGG
KVGFEIVNTASLQNLVCNNVRGPCPVASFQVQNIKETEPVIINSSTSQSQGSDINPTVIL
KETSTEL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgaacagacagacactctcggttttcctgttggcgctgggctttcttgtttgtgaagga
ggtaacccatgctgctcacagccgtgtgagaacagaggcgtgtgcacggcacttggaagt
gactatgaatgtgactgtactcgcactggatactatggacaaaactgcaccacacctgag
ctcctgacactgataaaggtttacctgaaaccatcgcccaacactgtccactacctgctc
acccacttcaagggcttctggaacatcatcaacagcatctcttttctccgggatgccatc
atgaaatatgtgctgacatcccgttccaatatgattgatagtccttcaacttataattca
gattacgattacaaaaattgggaagcctattctaacatctcatactatacccgtgccctc
cctcctttacctgaggattgccccactcctatgggtgtcgtaggtaagaaagagcttcct
gatgccaaggttttggctgaaaagctcctgatgagaagagagttcatcacagatccacaa
ggaaccagcctgatgtttggattctttgcacagcattttactcaccaattcttcaaaagt
gacatgaagaaaggacctgcttttactctggcaacagggcatggggtggacctcagccat
gtttatggtaacgacctgcagaagcaacacaagctcagactgttcaaggatggcaaactg
aaacatcaggtcttgaatggagaggtttatcctccaacagtgaaggaaacgggtgttcat
atgatctaccctcctcacatccctgagtctcagcgctttgctgtgggccacgaggccttc
ggcctggtccctggcctgatgatgtatgctgtcatctggctacgggagcacaatcgagtg
tgtgacgtgttgaaggaagtgcaccctgactgggatgacgagagacttttccaaaccaca
aggctcattctgattggtgagaccatcaggattgtgattgaagattatgtgcagcacctg
agtggctacaacttcaagctgaagtttgaccccgagcttctcttcaaagaacagttccag
taccagaaccgcatcgcctcagagtttaacacactctatcattggcaccccctgatgccg
gataccttccgtgtcggggagacacactacaattacaagcagtttatcttcaacaactct
gtagtgatagagcatggcatcaacaagatggtggagtcgtttaccaatcaaatttcagga
cgggttgctggtggccggaacgttcctgtgcctattctgtatgtgaccgttgagacaata
gagcacaacagaaaattgcgttaccagtccttaaatgcctacagaaaacgtttcaacatg
aagccctacagctcttttgaggacctgacaggagagacagaaatggcggcattgctggag
gaaatgtacggacatgtcgacgctgtagagttttaccctggccttcttgtggaaaaaccc
agacctaattccatctttggggagaccatggtggaggtaggggctcctttctccctgaag
ggactgatggggaatcccatctgctccccagagtactggaaacccagcacctttggtgga
aaagtaggctttgaaatcgtcaacacagcctctttgcagaatctcgtctgcaacaacgtt
cgtggcccctgtcccgtggcatcttttcaggtgcaaaacataaaagagacggagcctgtg
atcattaactccagcacatcccagtcacagggtagtgacatcaaccctacagtcatttta
aaagagacaagtacggagctgtaa

DBGET integrated database retrieval system