KEGG   Cynoglossus semilaevis (tongue sole): 103395954
Entry
103395954         CDS       T04866                                 

Gene name
stk11
Definition
(RefSeq) serine/threonine-protein kinase STK11
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04530  Tight junction
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103395954 (stk11)
   04150 mTOR signaling pathway
    103395954 (stk11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103395954 (stk11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103395954 (stk11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103395954 (stk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103395954 (stk11)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103395954 (stk11)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103395954 (stk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103395954
NCBI-ProteinID: XP_008332044
UniProt: A0A3P8W7Y9
LinkDB
Position
20
AA seq 436 aa
MSTGELHHLDYENELMEMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSYGKVK
EMLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLQHKNVIQLVDVLYNEEKQK
MYMVMEYCVCGMQEMLDSVPEKRFPVFQAHGYFCQLLDGLEYLHSQGIVHKDIKPGNLLL
TTDGALKISDLGVAEALHPFAEDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWSAGVT
LYNITTSLYPFEGDNIYKLFENIGKGDYTIPEECGPLLSDLLRGMLEYDPVKRFSIQNIR
QHNWVRKKHPPSEPPVPFPASAESRDPWRSMTVVPYLEDLHGYTEEDDDELYDGEDEIIY
TQDFTMPGQVTEDHQDQGIADHSPSVAKPVCVNGTESSALNSKAKAERRSSSSSNPSRKG
VSAASKIRKLSTCKQQ
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgagtaccggggagctgcatcacttggactatgaaaatgaactgatggaaatggatact
tttattcaccgcattgactctacagaagtgatctatcagccccggaggaagagagcaaag
ctgataggaaagtatttaatgggggatctgctgggagagggctcctatggcaaagtaaaa
gagatgctggactcagagacactttgtcgcagggctgtcaagatactgaagaagaaaaag
ctgaggaggattcctaatggagaggccaatgtaaaaaaagagattcagctgctaagaaga
ctccagcacaaaaatgtgattcagctggtggacgtcctgtacaatgaggagaagcagaaa
atgtatatggtgatggagtattgcgtttgtgggatgcaggaaatgttggacagcgtccca
gagaaaagatttccagtatttcaagctcacgggtacttttgccagctcttagatggcctt
gaatatttgcacagccagggaatagttcacaaagacattaaaccaggaaatctgctgctg
actacagatggggcccttaaaatctctgacctgggagtagcagaggcccttcatccgttt
gcagaggacgacacatgtcgcaccagtcagggctctcctgccttccagcccccagagatt
gctaatggactggacaccttttcagggtttaaagtagacatttggtctgcaggtgtaaca
ctatacaacatcacaacaagtctgtatccattcgagggcgacaacatctacaaactattt
gaaaacattggaaaaggagactacactattcctgaggagtgtggaccgctcctctcagac
ctgctccgaggaatgctcgagtacgacccagtgaagaggttttccatacagaacataagg
caacacaactgggtgcgtaagaaacaccccccatctgagccccctgtgcccttccctgcc
agcgcggagagcagggacccttggcggagcatgactgtggtgccctacttagaggaccta
catggctacacggaggaggatgatgacgaactctacgatggagaggatgaaatcatctac
actcaggacttcacaatgccaggacaagtgaccgaggatcaccaggatcaggggatcgcc
gatcacagtccttccgtagcaaagccagtctgtgtgaatggaacagagagcagcgctctg
aacagcaaggccaaagccgagcgccggtcctcctcctcgtccaacccgtcacgcaaagga
gtctctgcagccagcaagatccgtaagctctccacgtgcaaacagcaatga

DBGET integrated database retrieval system