KEGG   Cynoglossus semilaevis (tongue sole): 103396063Help
Entry
103396063         CDS       T04866                                 

Definition
(RefSeq) elongation of very long chain fatty acids protein 1-like
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00062  Fatty acid elongation
csem01040  Biosynthesis of unsaturated fatty acids
csem01100  Metabolic pathways
csem01212  Fatty acid metabolism
Module
csem_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    103396063
   01040 Biosynthesis of unsaturated fatty acids
    103396063
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csem01004]
    103396063
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     103396063
Lipid biosynthesis proteins [BR:csem01004]
 Elongase
  PUFA
   103396063
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 103396063
NCBI-ProteinID: XP_008332231
UniProt: A0A3P8WH60
LinkDB All DBs
Position
20
AA seq 313 aa AA seqDB search
MLRDMYSNILKIHNNLQSRTDARVKDYPLMKSPVEMTTILLAYVFFSVYVGPRLMANRKP
FSLKKPMVVYNLSMVLLNAYIVYEFLMAGWGTTYTWRCDLVDTSNSPMTLRMIQAAWLFY
FSKYIELLDTVFFVLRKKQSQITFLHVFHHSVMPWSWWWGITLTPAGGMGSFHALVNAVV
HVIMYFYYGLSAAGPRFQKYLWWKKYMTAIQLTQFVVISIHISQYYFMEKCDYQVPLWIH
MVWMYGIFFFLLFSNFWIQAYIKGNRLPSAKKLKMNGSTNDSISVVANGKHLENGHATHY
SNGKVLMGKVKEI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgagacatgtattcaaacattttaaaaatacacaataatctacaatcaagaact
gatgccagagtcaaagactatcctctgatgaagagtcctgtagagatgaccaccatcctg
ttggcttatgtcttcttctctgtttatgtcgggcctcgcttgatggccaatcgcaaacca
ttcagcttgaagaaacccatggttgtctacaaccttagcatggtgttattaaatgcctac
atagtgtatgagttcttaatggcaggatggggaaccacctatacatggagatgtgacctc
gttgacacctccaacagccctatgaccctcaggatgattcaagctgcatggctgttttat
ttttcaaaatacattgaacttcttgataccgtcttctttgtactgaggaagaaacaaagt
cagatcacatttcttcacgtgttccatcactcggtcatgccctggtcatggtggtggggc
atcaccttgactcctgctggaggaatgggctccttccatgccttagtgaacgccgtggtc
cacgtcatcatgtacttttactacggtctgtcggctgcaggacctcgctttcagaaatac
ctgtggtggaagaaatacatgactgccatccagcttacacagtttgtggtgatttccatt
catatcagccagtactacttcatggagaagtgtgactatcaggtccccctgtggatccac
atggtctggatgtatggcatcttcttcttcctcctcttctccaacttttggatacaggca
tatataaaaggcaatcgtcttccctcagcaaaaaagctaaaaatgaacggttcaacgaac
gattccatctctgtggtagccaacggcaaacatctggagaacggacatgcaacccactac
agcaacggcaaagtcctgatgggcaaagtaaaagagatctga

DBGET integrated database retrieval system