KEGG   Cynoglossus semilaevis (tongue sole): 103396493Help
Entry
103396493         CDS       T04866                                 

Gene name
amylase
Definition
(RefSeq) uncharacterized protein LOC103396493 precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00500  Starch and sucrose metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103396493 (amylase)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103396493 (amylase)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 103396493
NCBI-ProteinID: NP_001281147
UniProt: U3M7F5
LinkDB All DBs
Position
20
AA seq 512 aa AA seqDB search
MKLFVLLALFGLSVAQHNPHLRQGRTSIVHLFEWRWADIAEECERFLGPNGFGGVQISPP
NEHIVLGSPWRPWWQRYQPISYNLCSRSGSESELRDMITRCNNVGVNIYVDAVINHMCGA
GGGEGTHSSCGSWFNAGTKDFPSVPYSNLDFNDYKCRTSSGNIENYSDKYQVRDCRLVSL
LDLALEKDFVRDKVADFMNKLIDMGVAGFRVDAVKHMWPGDLDAVSRRLHNLNSKWFPDD
AKPFIFQEVIDLGGEAISAPEYFHLGRVTEFKYGAKLGTVFRKWNNEKLCYTRNWGEGWG
FMPNGNALVFIDNHDNQRGHGAGGAAILTFWDPRLYKMSVGFMLAHPYGVTRVMSSFHWD
RHFVNGKDQNDWMGPPSHGNGSTKPVPIKPDQTCGDGWVCEHRWRQIKNMVIFRNVVNGQ
PFTNWWDNNSNQVAFGRGNRGFIVFNNDDWDLNMTLSTGLPGGVYCDVISGQKEGNACTG
KQIHVGSDGRAHFFISNKDEDPFVAIHVDAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttgtgctgctggctctgtttgggctcagtgtggcccaacacaaccctcac
ctcaggcaggggaggacatccatcgtgcacctgttcgagtggcgctgggccgacattgct
gaagagtgcgagcgcttcttgggtccaaatggcttcggtggagttcagatctcccctcca
aatgagcacatcgtgctcggctccccctggaggccctggtggcagagataccagcccatc
agctacaacctgtgctccagatctggtagtgagtctgaactgagagacatgatcaccaga
tgcaacaacgtcggggtcaacatctacgtggacgccgtcatcaaccacatgtgtggagct
ggtggtggagaaggaacacactcctcatgtggcagctggttcaacgccggcaccaaagac
ttccccagtgttccttattccaacttggactttaacgactacaaatgcaggacatccagt
ggaaatattgagaactacagcgataaatatcaggtgcgtgactgtcgtctggtcagtctg
ctggatctggctctggagaaggactttgttcgggacaaggtggccgacttcatgaacaaa
ctgatcgacatgggcgtggccggattcagggtggatgccgtcaagcacatgtggcctgga
gaccttgacgctgtctctcgtcgtctgcataacctgaactctaagtggttccccgatgac
gccaaacccttcatcttccaagaggttattgatctgggaggtgaggctatttcagctcca
gagtatttccatctgggaagggtgacggagttcaaatacggtgccaaactgggaactgtg
ttcagaaaatggaacaacgagaagctgtgttacaccagaaactggggagaaggctggggc
ttcatgcccaatgggaacgccctggtcttcattgacaaccatgacaaccagaggggccac
ggtgcaggcggtgcggccatcctgactttctgggacccaaggctttacaaaatgagcgtg
ggcttcatgctggcccacccatacggagtaaccagagtgatgtccagcttccactgggac
cgccactttgtgaatggaaaggaccagaacgactggatgggcccccccagccacggtaac
ggatccaccaagcccgtccccatcaaaccagaccagacctgtggagacgggtgggtgtgt
gagcacagatggcgacaaatcaagaacatggtcatcttccgtaatgtggtcaacggacaa
cctttcaccaactggtgggacaacaacagcaatcaggttgcctttggacgtggtaaccgc
gggtttatcgtctttaacaacgatgactgggatctgaacatgaccctcagcactggtttg
cccggtggagtttactgtgatgtcatttctggacagaaggaaggaaatgcctgtactggg
aagcagatccacgtgggcagtgacggccgtgctcactttttcatcagcaacaaagatgag
gatccatttgttgctattcatgtcgatgcaaagctctga

DBGET integrated database retrieval system