KEGG   Cynoglossus semilaevis (tongue sole): 103396815Help
Entry
103396815         CDS       T04866                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem03030  DNA replication
csem03410  Base excision repair
csem03420  Nucleotide excision repair
csem03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103396815 (lig1)
   03410 Base excision repair
    103396815 (lig1)
   03420 Nucleotide excision repair
    103396815 (lig1)
   03430 Mismatch repair
    103396815 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103396815 (lig1)
   03400 DNA repair and recombination proteins [BR:csem03400]
    103396815 (lig1)
Enzymes [BR:csem01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103396815 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103396815 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103396815 (lig1)
DNA replication proteins [BR:csem03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103396815 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103396815 (lig1)
DNA repair and recombination proteins [BR:csem03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103396815 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     103396815 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     103396815 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 103396815
NCBI-ProteinID: XP_016897614
LinkDB All DBs
Position
20
AA seq 931 aa AA seqDB search
MQRSIASFFQPKSKDKEVQKKTAAEPVKKPVKSPLKVQNGVQETNSPVKKVVKRSRQILD
SDDDDSDVDEAPVVKEKVSDKRQGDKGVQRQTEKKDGVFKAVPTPLSPPPAPSTPVTPAT
PASSASPGTPTTPSSISPSGIVKRKTARKMLPKRKLDQSRSSSESQKEESEVKEQQGQES
KRPRVEVVDDSPGSPADPVEEGAKMEVEETPVTQVNSPDEEEEAENAKEGRRAASADEEE
KKAEGAEKKNEVKKGAAAAKKEKKMVEKDREEGEGEGEEEGEEEGERSPKSQVAKEQGDK
EAAKKTPISTFFAPRKSAVKMEKNEGEKKESGGRRSSGEESKDTKSESTSGQTEYDPSRP
NYHPVDHACWKQGQKVPYLAVARTFEKIEEDSGRLRNIETLSNLLRSVLLLSPDDLLCCV
YLCLNQLGPAYMGMELGVGETVLMKAVAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQR
MMFQPASLTAGGVFKKLKEIASMSGNSVSKKKINVFTLLVSLLFVLVVVTDRSLAGKLRI
GLAEQSVLSALTMAVCLTPPGQGFPPEVIDAGKGMSAESRRAWIEEKSLILKQTYWPPPG
VPLRPMLAHPTKGVGEVLKKFDEAAFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTSK
YPDIIARIPKVKTDSVVSCVLDTEAVAWDREKKQIQPFQVLTTRKRKDVDATEIKVQVCV
YAFDLLYLNGESLVRQPLSRRRSLLKDSFSEVEGEFVFARSINSNNTDTIAEFLEQSVRD
SCEGLMVKTLEKDATYEIAKRSHNWLKLKKDYLEGVGDTVDLCVIGAYLGKGKRTGTYGG
FLLACYDEENEEFQSVCKIGTGFKDEDLEQHYKFLKVDPEKGISLRFPRFLRIRDDKKPE
DATSGAQIADLYQKQQQIQNQGEKADLEDYY
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagcatagcatctttctttcagcccaagagcaaagacaaggaggttcagaag
aagacggcggctgaaccggtgaagaagcctgtaaagagtccactcaaggtgcagaacggc
gtgcaggaaaccaattcacccgtcaagaaagtggtcaagcgcagtcgtcaaatcttggac
agcgacgacgatgacagcgacgtcgacgaggccccggtggtgaaagagaaggtcagcgac
aagagacaaggagacaaaggagttcagaggcaaacggaaaagaaggatggagtcttcaag
gcggtgcccacacctctgtctcctccaccagctccatccacccctgtgactccggccacc
ccggcctcctcagcctccccaggaacccccaccacccccagctccatctccccgtcagga
atcgttaaacgcaagactgccaggaagatgttaccgaagaggaagctggaccagagcagg
agcagcagcgagagtcagaaggaggagtcggaggtcaaggagcagcagggtcaggaaagt
aaacgaccccgggtggaggtcgtcgatgacagtccaggcagccccgccgaccccgtggag
gaaggagcaaagatggaagtggaagagacgccggtgacccaggttaacagcccagatgaa
gaggaggaagcggagaatgccaaggaagggaggcgggcggcgagcgccgatgaggaggaa
aagaaagctgagggggcggaaaagaaaaatgaagtgaagaaaggagccgcggctgccaag
aaggagaagaagatggttgaaaaggacagggaggagggagagggggagggagaggaagag
ggagaggaagagggagagaggagcccgaaaagtcaagtggccaaagagcagggagataag
gaggcggccaagaaaactcccatcagcactttctttgcccccagaaaatctgcagtgaag
atggagaagaacgagggcgagaaaaaggagagcggcgggaggaggagctccggggaggag
agtaaagacaccaaaagtgagtcaacttcaggacagacagagtacgatccgtccagaccc
aactatcaccccgtcgaccacgcctgctggaaacaagggcaaaaggtaccgtacctggcc
gtggctcggacctttgagaagatcgaggaggactctgggagactgaggaacatcgagacg
ctgtcgaacctgctccgctccgtgctgctgctctctccagacgacctgctgtgctgcgtg
tacctgtgtttgaaccaactcggtcccgcctacatggggatggagctcggtgtcggagag
acggtcctgatgaaagccgtcgctcaggccactgggcgacagttggacaaaatcaaagcc
gaggctcaggagaaaggagacttgggtctggtggccgagagttcccgtagcaaccagcgc
atgatgttccagccggccagtctgacagcagggggcgtgttcaaaaaactgaaggagatt
gcgagcatgagtggaaactcggtgagcaaaaaaaaaatcaacgtttttactctattagtc
tcattgttgtttgttcttgtggttgtgacggacaggtctctggccgggaagctgaggatc
ggcctggctgagcagagcgtcctgtcggcgctgactatggccgtgtgtctgacaccaccg
ggacaaggtttccctccagaagtgattgatgcagggaagggaatgagcgccgagagcaga
cgggcctggatcgaagagaagagtctgatcctcaaacagacctattggcctccaccagga
gtccccctcagacccatgctggctcaccccacaaagggcgtgggcgaggtgctgaagaag
tttgacgaggcggcgttcacgtgcgagtacaagtacgacggcgagcgcgcacagatccac
atcctggagaacggagaggtgcgaattttcagccgcaaccaggaagacaacaccagcaaa
taccctgacatcatcgcccgcatccctaaggtgaagacggactcggtcgtgtcctgcgtc
ctcgacaccgaagctgtcgcctgggaccgagagaagaagcagatccagccgttccaggtt
ctcaccaccaggaagagaaaggatgtggacgccacagagatcaaagttcaagtctgcgtc
tacgcctttgaccttctgtatctgaacggcgagtccctggtgcggcagccgctgtctcgg
cgtcggtccctcctgaaggacagcttctctgaggtggagggagagtttgtgttcgcccga
tccatcaactccaacaacaccgacaccatcgccgagttcctggagcagtcggttcgagat
tcctgtgaaggtctaatggtgaagacactggagaaggacgccacctatgaaattgccaag
cgctctcataactggctgaagttgaagaaggactacctagagggcgtcggagacaccgtg
gacctgtgcgtgatcggcgcctacctggggaagggcaagaggacgggcacctacgggggc
ttcctgctggcctgctacgatgaggagaacgaggagttccagtccgtctgtaagatcggc
acaggttttaaagacgaagatctggagcagcattacaagttcttaaaggttgaccctgag
aaaggaatttctctgaggtttcctcgcttcctgagaattcgagacgacaaaaaacccgag
gacgccacgagcggagctcagattgcagatttgtaccagaagcagcagcagatccagaac
cagggggagaaggcggacctggaggactactactga

DBGET integrated database retrieval system