KEGG   Cynoglossus semilaevis (tongue sole): 103397146Help
Entry
103397146         CDS       T04866                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase, mitochondrial-like
  KO
K07508  acetyl-CoA acyltransferase 2 [EC:2.3.1.16]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00062  Fatty acid elongation
csem00071  Fatty acid degradation
csem00280  Valine, leucine and isoleucine degradation
csem01100  Metabolic pathways
csem01212  Fatty acid metabolism
Module
csem_M00085  Fatty acid elongation in mitochondria
csem_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    103397146
   00071 Fatty acid degradation
    103397146
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103397146
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     103397146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N TraT
Motif
Other DBs
NCBI-GeneID: 103397146
NCBI-ProteinID: XP_016898150
LinkDB All DBs
Position
W
AA seq 214 aa AA seqDB search
MSCKAQTHARHVGLRCGVPVPVPALTVNRLCGSGFQAIVSGAQLEDTMWAGLTDLHIKIP
MGITAENLAEKYQITREDCDNYTYQTQQRWKAGHEAGHFAAEIAPIDIKAKKGKVPVTQD
EHPRPQTTVEQMAKLAPVFKKQGTVTAANALGVSDGAAAVIIASEDAVKEHKLNPLARLM
SYHPSGCDPSIMGIGETKGCGAFKENMSNELLRR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcaaggctcagacccacgctcgtcacgtgggtctgaggtgtggtgttccagtt
ccagtgcctgcacttacagtgaacagattgtgtggatctggttttcaggccattgtcagt
ggtgctcagctggaggacactatgtgggccggtcttactgacctccatataaaaatcccc
atgggcataacagcagaaaacctagcagagaaataccaaatcacccgggaagactgtgat
aactacacatatcagacacaacagagatggaaggctgggcatgaggctggtcacttcgca
gcagaaatcgcccccattgacataaaagctaagaagggaaaggttcctgtgactcaggac
gaacaccctcggcctcagaccacagtggaacagatggcaaaactggctcctgtttttaag
aagcaaggaacagtcaccgctgccaatgccttgggtgtgtctgacggtgctgccgctgtc
atcattgccagtgaagatgctgtgaaggagcacaaactcaatcctctggccaggttgatg
tcctaccacccgtccggctgtgacccaagcatcatgggaatcggtgagacaaaaggctgc
ggtgcttttaaggaaaacatgagtaatgaattgttgcgacgttga

DBGET integrated database retrieval system