KEGG   Cynoglossus semilaevis (tongue sole): 103397598Help
Entry
103397598         CDS       T04866                                 

Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103397598
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103397598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103397598
NCBI-ProteinID: XP_008334142
LinkDB All DBs
Position
Z
AA seq 592 aa AA seqDB search
MSVFRIFCVWFYINMMLLQISPCVGDSNTVNPCCNYPCQNAGVCVRFGSDGYQCDCTRTG
HTGKNCTVPEFWTRVYLLLPHVVHYILTNFQWFWNIVNNSFLQDTIMRIVLTVRSDLIPS
PPTYNTKYGYLSWESYYNITYYTRLLPPVPEDCPLPMGSKGTPVLPDPKVLTQRFFKRIK
FRPDPQGTNLMFAFMAQHFTHQFFKTDHGRDAGFTKGLGHGVDASNIYGDTLERQHELRL
HEDGKLKYQLVNGDVYPPSVSKVPVHMIYPEGFPAEQRLAIGQEVFGILPGLTMYATLWL
REHNRICDILKAEHPTWDDEQLFQTTRLIIIGEIINIIIEEYVQQLSGYHLDLKFDPSLL
FNARFQYSNRIALEFCHLYHWHPLMPDSFLIDGDEIPYPSFFYNTSLLMHYGVEKLVDAF
SRQPAGQIGGGRNSNEVVLRVAEMVIRESRAARIQPFNQYRKRFNLKPYCSFDEFTDDPE
MAQGLEELYGDIDALEFYPGVLLEKTRSNAIFGESMVEMGAPFSLKGLMGNPICSPEYWK
PSTFGGDTGFNIVKTATIKKLVCLNSRWCPYVNFHIPRNEEEAKPRKPSTEL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtttcgtatcttctgcgtctggttctacatcaacatgatgctgctgcagatt
tcaccgtgtgttggtgactcaaacactgtgaatccttgctgtaactatccatgccagaac
gcaggagtgtgtgtgaggtttggttcagatggctaccagtgcgactgcacccgcacgggc
cacactgggaaaaactgcactgtccctgagttctggaccagagtgtacctcctgctgcct
catgtggttcattacatcctcaccaacttccagtggttttggaacatagtcaacaactct
tttctgcaggacaccatcatgcgaattgtactgacagtcagaagtgacctcatccccagt
cctcccacctacaacaccaagtatggatacctcagctgggagtcttactacaacatcaca
tactacacccgcctcctaccgcctgtacctgaagactgccctttacccatgggatctaaa
ggtacacctgttctgcctgatcccaaagtattaacgcagcgtttcttcaaaagaataaag
ttcagacccgatcctcagggaaccaatttgatgtttgccttcatggcccagcattttacc
caccagttttttaagactgaccatggaagggatgctggcttcaccaaaggactaggacac
ggggtggacgccagtaacatttatggagacactcttgagcgacagcatgaactacgactt
catgaagatggaaagctgaaatatcagctagtaaacggggacgtctaccccccgtctgtg
tccaaggtcccggtacacatgatctaccctgaaggttttcctgcagagcaacgtctggct
atcggtcaggaggtttttggcatcctgcctggtctcaccatgtacgccaccttatggctg
agggagcataacaggatctgtgacatccttaaagcagaacatcccacctgggacgacgag
cagctgttccagaccactaggctcatcatcattggagagatcatcaacatcatcatagag
gagtatgtgcagcagctgagtggttaccacctggacctgaagttcgatccctccctgctc
ttcaatgcacggtttcagtacagcaaccgcatcgccctggagttctgtcatttgtaccac
tggcacccactgatgcctgacagcttcctcattgatggggatgaaatcccctatccctcc
tttttttataacacctcgctactgatgcattacggcgtggagaaattggtggacgctttc
tccagacagcctgcaggacagatcggtggaggtcgaaactccaatgaagttgtcctgaga
gtggcagagatggtgatcagagagtccagagcagcacggatccagcccttcaatcagtac
aggaaacgcttcaacctgaagccgtactgctcttttgatgagttcactgacgacccagaa
atggcccaaggtttggaagagctctacggtgacattgatgctttggagttctaccccgga
gtcctgctggagaaaacgcgctctaatgccatatttggtgagagtatggttgagatgggc
gctcccttctccctgaaaggcctgatgggtaatcccatctgttctccggagtactggaag
ccaagcaccttcggaggagacactggtttcaacatagttaaaacagcaactataaagaag
ctggtgtgtctcaacagcaggtggtgtccgtatgtcaacttccacattccaagaaacgag
gaagaggccaaaccacggaaaccatcaacggaactttag

DBGET integrated database retrieval system