KEGG   Cynoglossus semilaevis (tongue sole): 103398085Help
Entry
103398085         CDS       T04866                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00512  Mucin type O-glycan biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103398085 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103398085 (galnt9)
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103398085 (galnt9)
Glycosyltransferases [BR:csem01003]
 O-Glycan biosynthesis
  Mucin-type
   103398085 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 103398085
NCBI-ProteinID: XP_008334806
LinkDB All DBs
Position
Z
AA seq 604 aa AA seqDB search
MALARKIKTLLTVNILVFVGIILFSVYCRIQDRSGELLQLGRASDQRLRTRNGKVPNSVE
RQSILQRLERLEDVVYNQLNGLAKPIGLVEGPGGLGQGGAAATLGEDSREAEGKYEEYGY
NAQLSDRISLDRSIPDYRPKKCRQLSYPEELPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDSVELKFNLDQYVNRRYPGLVKIVRNSRREGLIRARIHGWNAATSP
VVGFFDAHVEFNTGWAEPILSRIKEDHSRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQEWLDKGDETAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCARVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEYKSHVYMAWNIP
MNNPGVDFGDVSERLALRKKLHCRSFRWYLDHVYPEMRIYNNTITYGEVRNSKASGYCLD
QGSEEDDKAILYPCHGMSSQLARYSTEGLLQLGPLGSTTFLPDTKCLVDDGRGRTPSLKK
CNTVSRIGQRLWDFTQNGPIINRDSGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HPKH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcacgcaaaatcaaaaccctgctgaccgtcaacatcctcgtgttcgtgggg
atcatcctgttctcggtgtactgcaggatccaagaccgatctggagagctgctccagctg
ggacgagcgtccgatcagaggctgaggaccaggaatggtaaagttcccaactccgtggag
agacagtcaattctccagcgacttgagaggctggaggacgtggtctacaaccagttaaat
ggtttagcaaagcccatcggcctggtggagggaccgggaggactcggccaggggggcgct
gctgccaccctgggtgaggatagcagagaggcggaagggaagtacgaggagtacggctac
aacgctcagctgagcgaccgcatctccctagacagaagtatcccagactacagacccaaa
aagtgcaggcagctgtcgtacccagaggagttgcctcagatttccgtggtcttcatcttt
gtcaacgaagcgctctctgtcatcctgcggtcggtgcacagcgtggtcaaccacacgccg
tcacacctgctcaaggagatcatcctggtggacgacaacagcgacagtgtggagctgaag
ttcaacctggaccagtacgtgaacagacgttaccccggcctcgtgaaaatagtgaggaac
agcaggagggaggggctgatccgagcccgaatccacgggtggaacgcggccacctccccc
gtggtgggcttcttcgacgcccacgtggagttcaacaccggctgggctgaaccaatcctc
agtcgtattaaggaggaccactctcgcatcattctgccggccatcgacaacatcaagtac
aacaccttcgaggtgcagcagtacgccaacgccgcccacggctacaactggggactgtgg
tgcatgtacatcattcccccgcaggaatggctggacaagggcgacgagactgcccccatc
agaactcctgctatgattggctgctccttcgtggtagaccgggagtacttcggtgagatc
ggtctgcttgatcctggaatggaggtctacggaggggagaacatagagctggggatgagg
gtgtggcagtgtgggggcagtatggaggtcctgccctgtgccagagtggcccacattgag
cgcaccaagaagccctacaacaacgacatagattactacgccaagcgcaacgctctgcgg
gctgccgaggtgtggatggacgaatacaagtcccacgtctacatggcctggaacatcccc
atgaataacccaggggtggatttcggggacgtctcagagaggttggccctaaggaagaag
ctacattgtcggagtttccgctggtacctggaccacgtctacccagagatgaggatctac
aacaacaccatcacatatggagaggtgagaaacagcaaagcaagcggctactgtctggac
cagggctctgaggaagacgacaaggccatcctctacccctgccacggcatgtcctctcag
ctcgcccgttactcaaccgaggggctcctccagctcggacccctgggatccacgaccttc
ttgccggacacaaaatgtctggtggacgacggcaggggacgcacacccagtctgaagaaa
tgcaatactgtttcaaggatcggtcaaagactctgggacttcactcagaatggtccaatc
atcaacagggacagcggccgatgtttggaggtggaaatgtccaaagacgctaattttggc
ctccgtctggtggtccagaggtgttcaggacagaagtggatgataagaaactggatcaaa
catcccaagcactga

DBGET integrated database retrieval system