KEGG   Comamonas serinivorans: CCO03_00605Help
Entry
CCO03_00605       CDS       T04892                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cser  Comamonas serinivorans
Pathway
cser00480  Glutathione metabolism
cser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCO03_00605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cser02000]
    CCO03_00605
Enzymes [BR:cser01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CCO03_00605
Transporters [BR:cser02000]
 Other Transporters
  Pores ion channels [TC:1]
   CCO03_00605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_2 GST_C_2 GST_C_3 GST_N_3 GST_N_5
Motif
Other DBs
NCBI-ProteinID: ARU03381
UniProt: A0A1Y0EIZ1
LinkDB All DBs
Position
complement(154636..155244)
Genome map
AA seq 202 aa AA seqDB search
MKLYFSPGACSLSPHIVLEETGLPYTLVKASTKTHQLDDGTDFYTINPLGYVPVLELADG
RRLFEGPAIVQYLADQAPEKHLAPANGTFERYRLQGWLNFVGTEVHKSFGPLFNPKSSDE
VKANAKAYISKRLAWVDSELAQRPYLNGDAVSVADFYLFVVTNWAKPVGLDIAGLTHLNA
FRDRIANRPAVQAAMRQEGLLG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtatttctcgcccggcgcctgctcgctgtccccgcacatcgtgctggaagaa
accggcctgccctacaccttggtcaaggcctcgaccaagacccaccagctggatgacggc
accgatttctacacgatcaacccactggggtatgtgcccgtgcttgagctggccgacggc
cgccgcctgtttgagggcccggccatcgtgcaatacctggccgatcaagcgcccgagaaa
cacctggccccggccaacggcaccttcgagcggtatcgcctgcaaggctggctgaacttc
gtcggcaccgaagttcacaagagtttcggcccgctgttcaaccccaagtcgtccgacgag
gtgaaagccaacgccaaggcctacatcagcaagcgcctggcctgggtggacagcgagctg
gcccagcggccctacctcaacggcgatgccgtgtcggtggccgacttctacctgttcgtg
gtcaccaactgggccaagcccgtgggcctggacatcgctggcctgacccacttgaacgcc
tttcgcgaccgcatcgccaaccgcccggccgttcaggccgccatgcgtcaagagggcctg
ctgggctga

DBGET integrated database retrieval system