KEGG   Comamonas serinivorans: CCO03_11675Help
Entry
CCO03_11675       CDS       T04892                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cser  Comamonas serinivorans
Brite
KEGG Orthology (KO) [BR:cser00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CCO03_11675
Enzymes [BR:cser01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CCO03_11675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 DAO HI0933_like FAD_oxidored NAD_binding_8 Thi4 Glutaredoxin FAD_binding_3 NAD_binding_7 K_oxygenase AlaDh_PNT_C DSBA NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ARU05249
UniProt: A0A1Y0EPM4
LinkDB All DBs
Position
2767033..2768598
Genome map
AA seq 521 aa AA seqDB search
MLDTDLKQQLAAYLERVTLPFEMVASLDDGAKSAELRELLEDIAGMSDKITLKTDGNDAR
KPSFTLQRQGTATQLRFAAIPLGHEFTSLVLALLWTGGHPPKAPADVLEQIRHLDADLDF
EIYMSLSCHNCPDVVQALSLMAIHNPRVKVTVIDGGLFQQEIEDREIMGVPTVFLNGRYF
ANGRMTVEEILQKVDTGAAKRDAAKLSAKAPFDVLVVGGGPAGAAAAIYAARKGIRTGVV
AERFGGQVNDTLEIANYPGVPETTGPQYAAALEQHVRNYEVDIMNAQQVVKLVPAEQAGG
LLQVQLANGGVLHSRTVILATGARWRNVNVPGEQEYKTKGVAYCPHCDGPLFKGKDVAVI
GGGNSGIEAAIDLAGLVKHVHVVEFMPELKADQVLVNKLHTLPNVTVHTNKQTTEIHGAE
GKVNALNFKCRASGDETRVALEGVFVQIGLVPNTEFLGDTVERTRFGEIVVNARGETNVP
GVFAAGDCTTVPYKQIVVAAGSGSTAALSAFDHMIRTPEVK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccgatctcaaacaacaactggctgcctacctggagcgcgtgacgctgccg
tttgagatggtggcctcgttggacgacggcgccaaatccgccgagctgcgcgagctgctc
gaggacatcgctggcatgagcgacaagatcacgctcaagaccgatggcaacgacgcgcgc
aagccctcgttcacgctgcaacgccagggcacggccacgcagctgcgctttgccgccatc
ccgctgggccatgaattcacctcgctggtgctggcgctgctgtggaccggcggccacccg
cccaaggcccccgccgacgtgctcgagcagatccgtcacctcgacgccgacctcgacttc
gagatctacatgagcctgtcgtgccacaactgccccgacgtggtgcaggccctgtcgctg
atggccatccacaacccacgcgtcaaggtcaccgtgatcgacggcggcctgttccagcag
gagatcgaagaccgcgaaatcatgggcgtgcccacggtcttcctgaacggccggtacttc
gccaacggccgcatgacggtggaagaaatcctgcagaaggtggacaccggcgccgccaag
cgcgacgccgccaagctcagcgccaaggccccgttcgacgtgctggtcgtgggcggtggc
ccggccggcgcggcggcagccatctacgccgcccgcaagggcatccgcaccggcgtcgtg
gccgagcgctttggcggccaggtgaacgacacgctggagatcgccaactaccccggcgtg
cccgagaccacgggcccgcagtacgccgccgcgctggagcagcacgtgcgcaactacgag
gtggacatcatgaacgcccagcaggtcgtcaagctggtgccggccgagcaagccggcggg
ctgctgcaggtgcaactggccaacggcggcgtgctgcacagccgcaccgtcatcctggcc
acgggcgcgcgctggcgcaacgtgaacgtgcccggcgagcaggagtacaagaccaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaaggacgtggccgtgatc
ggcggcggcaactcgggcatcgaggccgcgatcgacctggctggcctggtcaagcacgtg
cacgtggtcgagttcatgcccgaactgaaggccgaccaggtgctggtcaacaagctgcac
accctgcccaacgtgaccgtgcacaccaacaagcagaccacggagatccacggcgccgaa
ggcaaggtcaacgccttgaacttcaagtgccgcgcctctggcgacgaaacccgggtggcg
cttgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagttcctcggtgacacg
gtggagcgcacccggttcggcgagatcgtcgtcaacgcgcgcggcgagaccaacgtgccc
ggcgtgttcgcggccggtgactgcaccacggtgccctacaagcaaatcgtggtggccgca
ggatcgggctcgactgccgcactgagcgccttcgaccacatgatccgcacgcccgaggtg
aagtga

DBGET integrated database retrieval system