KEGG   Comamonas serinivorans: CCO03_12960Help
Entry
CCO03_12960       CDS       T04892                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cser  Comamonas serinivorans
Pathway
cser00020  Citrate cycle (TCA cycle)
cser00190  Oxidative phosphorylation
cser00650  Butanoate metabolism
cser01100  Metabolic pathways
cser01110  Biosynthesis of secondary metabolites
cser01120  Microbial metabolism in diverse environments
cser01130  Biosynthesis of antibiotics
cser01200  Carbon metabolism
Module
cser_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CCO03_12960 (sdhB)
   00650 Butanoate metabolism
    CCO03_12960 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CCO03_12960 (sdhB)
Enzymes [BR:cser01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CCO03_12960 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CCO03_12960 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_9 Fer4_7 Fer4_16 Fer4_18 Fer4 Fer4_4 Fer4_20
Motif
Other DBs
NCBI-ProteinID: ARU05474
UniProt: A0A1Y0EP98
LinkDB All DBs
Position
3065900..3066607
Genome map
AA seq 235 aa AA seqDB search
MQKRTFKIYRYDPDKDAKPYMQTVEIELEGNERMLLDALIKLKAIDPTISYRRSCREGVC
GSDAMNINGKNGLACLTNLRTLKGDIVLKPLPGLPVIRDLIVDMTNFFNQYHSIKPYLIN
ETPVSPDKERLQSPEEREELNGLYECILCASCSTSCPSFWWNPDKFVGPAGLLQAYRFIA
DSRDDATGARLDNLEDPYRLFRCHTIMNCVDVCPKHLNPTKAIGKIKELMVRRAV
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgcactttcaagatctatcgttacgatcccgacaaggatgccaagccttac
atgcagaccgtggagatcgagcttgagggcaacgagcgcatgctgctcgacgcactgatc
aagctcaaggccatcgaccccacgatctcgtaccgccgctcctgccgcgaaggcgtgtgc
ggctccgacgccatgaacatcaatggcaagaacggtctggcctgcctgaccaacctgcgc
acgctcaagggcgacatcgtcctcaagcccctgccgggcctgcccgtgatccgcgacctg
atcgtggacatgaccaacttcttcaaccaataccactcgatcaagccttacctgatcaac
gagacgccggtgtcccccgacaaggagcgcctgcagtcgccggaagagcgtgaagaactc
aacggcttgtacgagtgcatcctgtgcgccagctgctcgaccagctgcccctcgttctgg
tggaaccccgacaagttcgtgggcccggctggtctgctgcaggcctaccgcttcatcgcc
gacagccgcgacgacgccacgggcgcccgcctggacaacctcgaggacccgtaccgcctc
ttccgctgccacacgatcatgaactgtgtggacgtgtgccccaagcacctgaacccgacg
aaggccattggcaagatcaaggagctgatggttcgccgagccgtctga

DBGET integrated database retrieval system