KEGG   Comamonas serinivorans: CCO03_18505Help
Entry
CCO03_18505       CDS       T04892                                 

Definition
(GenBank) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cser  Comamonas serinivorans
Pathway
cser00564  Glycerophospholipid metabolism
cser01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CCO03_18505
Enzymes [BR:cser01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CCO03_18505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 NAD_binding_8 Pyr_redox_2 3HCDH_N Thi4 Lycopene_cycl Trp_halogenase HI0933_like Pyr_redox GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ARU06973
UniProt: A0A1Y0ETP3
LinkDB All DBs
Position
complement(4310707..4312308)
Genome map
AA seq 533 aa AA seqDB search
MTPAEASTDRRTLLAQIARPQPWDLAVVGGGATGLGVALLAARRGLRVVLVEADDFASGT
SSRSTKLVHGGVRYLAQGRVALVRQALHERKRLMQAAPHLVQPLPFVVPAHRAWDNGLHR
LGLGVYDWLAGADSLGRTEWLSNQALHQAVPGFSDDLHNGGIRYWDAQFDDARFALALAR
SAVAHGAVLLNHCPAVRLLRDAGRVRGLVCRDAELGVTHTLRARCVVNATGVWSDAVRGD
GDGRGAATVLLSRGAHLVVPQAGLLNDHAVLLPQTADGRVLFAVPWLGHVLLGTTDTPHP
APARDPLPSAAEVAFILTEINRYTRRPLQPTDVRSLWAGLRPLALAAGAPHGASPTLSRE
HRVHVAADGLISVVGGKWTTFRVMAVDALAGVALQLGCPPWVGQDAELPRLAGAPEVGDA
LPAPLHRPPDGLGLGRDAAAVQQLPGADRVLGLGLSEARVRFAVRHEFARTVADVLARRA
RVLMLDAACAERLVPRVAAILREEGVPDPQPAHALLLSRQQLALTRASQSVLT
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggccgaggccagcaccgaccggcgcaccttgctggcgcagatcgcgcggcca
caaccgtgggacctggccgtggtgggcggcggcgcgaccggcctgggggtggcgctgctg
gcggcgcggcgcggcctgcgcgtggtcctggtcgaggccgacgacttcgccagtggcacc
tcctcgcgctcgaccaagctggttcacggcggcgtgcgctacctggcgcaaggccgcgtg
gccctggtgcgccaggcgctgcacgaacgcaagcggctgatgcaggctgcgccgcacctg
gtgcagcccttgcccttcgtggtgccggcccaccgcgcctgggacaacgggctgcatcgc
ctgggcttgggcgtttacgactggctggcgggtgcggacagcctggggcgcaccgagtgg
ctctccaatcaggctttgcatcaagcagtacccggcttctccgatgatctgcacaacgga
ggtattcgatactgggatgcgcagttcgacgatgcgcgcttcgccttggcattggcgcgc
agtgcggtggcgcacggagccgtgctgctcaaccactgtcccgccgtgcgcctgctgcgc
gacgccggccgggtgcggggcctggtgtgccgcgacgccgagctgggcgtcacccacacc
ctgcgggcccgctgcgtggtcaacgccacgggcgtctggtcggatgccgtgcggggcgac
ggcgacgggcgcggcgccgccaccgtgttgctgagccgtggggcgcacctggtggtgccg
caggcgggcctgctcaacgaccacgccgtgttgctgccgcaaacggcggacgggcgcgtg
ctgttcgcggtaccgtggctgggccatgtgctgctgggcaccacggacacgccccatccg
gcgccggcgcgcgaccccttgccatcggctgccgaggtggccttcatcctgacggagatc
aaccgctacacgcggcggccgctgcagcccacggatgtgcgcagcctgtgggcggggctg
cggcccttggcgctggccgcgggtgccccgcatggcgccagccccaccctgagccgcgag
caccgcgtgcacgtggccgcagacggcctgatcagcgtggtcggtggcaagtggaccacc
ttccgcgtcatggccgtcgacgccttggcaggcgtggcgcttcagctgggctgcccaccg
tgggtggggcaggacgctgagctgccgcgcctggccggcgcgcccgaggtgggcgacgct
ttgcccgcgccgctgcatcggccgcccgatgggctggggctgggccgtgatgccgccgcc
gtgcagcagctgcccggcgcagaccgcgtgctgggcctgggcctgagcgaagcccgcgtg
cgcttcgccgtgcgccacgagttcgcgcgcacggtcgccgacgtcctggcgcgtcgggcg
cgcgtgctgatgctggacgcggcctgtgccgagcgcctggtgccgcgcgtggccgcgatc
ctgcgcgaggaaggcgtgcccgacccgcagccggcgcacgcgctgttgttgtcacgccaa
caactcgccttgacgagggccagtcagtcagttctgacttga

DBGET integrated database retrieval system