KEGG   Campylobacter subantarcticus LMG 24377: CSUB8523_1798Help
Entry
CSUB8523_1798     CDS       T03572                                 

Gene name
aroC
Definition
(GenBank) chorismate synthase
  KO
K01736  chorismate synthase [EC:4.2.3.5]
Organism
csf  Campylobacter subantarcticus LMG 24377
Pathway
csf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csf01100  Metabolic pathways
csf01110  Biosynthesis of secondary metabolites
csf01130  Biosynthesis of antibiotics
csf01230  Biosynthesis of amino acids
Module
csf_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:csf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CSUB8523_1798 (aroC)
Enzymes [BR:csf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.5  chorismate synthase
     CSUB8523_1798 (aroC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_synt
Motif
Other DBs
NCBI-ProteinID: AJC93271
LinkDB All DBs
Position
complement(1754601..1755689)
Genome map
AA seq 362 aa AA seqDB search
MNSFGKRFKFTSFGESHGQAIGCVIDGMPAGVKFDFDFLQEMLDKRKPGQNKFSTPRKEE
DKAQVLSGVFEGYTTGAPISVLVYNENTRSKDYEKDVFRPAHADFTYYHKYGIRDYRGGG
RASAREGIARVAAGTVAQMLLKEFDIEIMSGVFGVGNIDSKLNNDEFDFDYAKNSEVYAL
DKNLEQSFKDEILKAKKAKNSIGARVFTRVKNPIKGLGEPLYDKLDSKLAHAIMGVNAVK
AIEIGSGIQSSYMYGSQNNDELKDGVFLSNHSGGILGGISNGDFVDIKTYFKPTPSIFLP
QQTQNTQGENIIHELKGRHDPCVGIRGSVVVNAMVAICMADALLLNVSSNLQNLQRVYGK
NK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaatagctttggaaaaagatttaaatttacaagctttggcgaatctcatggtcaagct
ataggttgtgtaatagatggtatgccagcaggagtgaagtttgattttgattttttgcaa
gaaatgctagataaaagaaaaccaggtcaaaataaatttagtactcctagaaaagaagaa
gataaggctcaagttttaagcggggtttttgagggttatacaacaggggctcctataagt
gttttggtatataatgaaaatacacgctcaaaagattatgaaaaagatgtatttcgtccc
gcgcatgctgattttacttattatcacaaatatggcattagagattatagaggtggtgga
agagctagtgctagagaaggtatagcaagagtagcagcaggaactgtggcacaaatgctt
ttaaaagaatttgatatagagataatgagcggagtttttggagtaggaaacattgatagc
aaacttaacaatgatgagtttgattttgattatgctaaaaatagtgaagtttatgcttta
gataaaaatttagaacaaagttttaaggatgaaattttaaaggctaaaaaggctaaaaat
agtataggtgctagagtttttactagagtaaaaaatcctattaaaggtttaggtgagcct
ttgtatgataagcttgattctaaacttgctcatgcgattatgggagtaaatgctgttaaa
gctatagaaataggaagtggtattcaaagtagctatatgtatggaagtcaaaataatgat
gagttaaaagatggggtgtttttaagcaatcatagtggtgggatattaggtggaatttct
aatggagattttgttgatataaaaacttattttaaaccaaccccttctatatttttaccc
caacaaacgcaaaatactcaaggagaaaatattatacacgagctaaaaggcaggcatgat
ccttgtgtgggtataagaggtagtgttgtagtaaatgctatggtagctatatgcatggct
gatgctttgcttttaaatgtaagctcaaatttgcaaaatttacaacgcgtttatggaaaa
aataaataa

DBGET integrated database retrieval system