KEGG   Cylindrospermum stagnale: Cylst_0755Help
Entry
Cylst_0755        CDS       T02398                                 

Definition
(GenBank) HEAT repeat-containing protein
  KO
K02288  phycocyanobilin lyase subunit alpha [EC:4.4.1.32]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00196  Photosynthesis - antenna proteins
csg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    Cylst_0755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:csg00194]
    Cylst_0755
Enzymes [BR:csg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.32  C-phycocyanin alpha-cysteine-84 phycocyanobilin lyase
     Cylst_0755
Photosynthesis proteins [BR:csg00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    Cylst_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT_EZ Arm
Motif
Other DBs
NCBI-ProteinID: AFZ23082
UniProt: K9WUA1
LinkDB All DBs
Position
854057..854911
Genome map
AA seq 284 aa AA seqDB search
MIEPSGSEYSADNGPHLTPELGFAEGVRDAIANLQSSDLSLRYYAAWWLGKFRVSQPDAI
DGLIAALEDEADRTELGGYPLRRNAARALGKLSNAKAVPGLIKCLECPDFYVREAAAQSL
EMLRDKTAVSALIGLLDGGVSGAVQVPGRPHLTQPYEAVIEALGSIGATEAIYLIQPFLE
HPVPGVQCAAARAMYQLTQDPAYGEHLVKMLDNNDLKLRRVALGDLGAIGYVASAEAIAY
AKAENSFKLIALKGLLEHQLTGELDFLSVSDDAIRVMKLMDSLL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacccagtggatcagaatattctgccgataatgggccacatctcacaccagag
ctagggttcgccgaaggcgtgcgggacgcaatcgccaatctgcaatcatcagatttaagt
ctccgctattatgctgcttggtggctgggtaaattccgggttagtcaaccagatgctata
gatggactaattgcggcgttagaggatgaagccgacagaactgaattgggaggttatcca
ctacgacgcaatgcggccagagcactggggaaactcagcaatgccaaagctgtaccaggc
ttgattaagtgtttagaatgtcctgacttctacgtgcgcgaagcagcagcccaatccctg
gaaatgctccgggacaaaacagcagtatctgcactcataggactgctagatgggggtgtc
tcaggtgccgtgcaagtacccggacgcccccacctaacccagccctacgaagcagtgatc
gaagccttgggatctattggtgcaactgaggctatttacctcattcagcctttcttagag
catccagtaccaggtgtgcagtgcgccgcagccagagcaatgtaccaacttacacaagac
cctgcttatggggaacacttagtgaaaatgttggacaacaacgatctgaaattgcgccgt
gttgctttaggggacttgggtgcaatcgggtatgtggcctctgcggaggcgatcgcttat
gccaaagccgaaaatagcttcaaactcattgccctcaaaggattgcttgagcatcaactc
accggcgagttagatttcctcagtgtttctgatgatgcaatccgggttatgaagttgatg
gattcacttttgtag

DBGET integrated database retrieval system