KEGG   Cylindrospermum stagnale: Cylst_0973Help
Entry
Cylst_0973        CDS       T02398                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00473  D-Alanine metabolism
csg00550  Peptidoglycan biosynthesis
csg01100  Metabolic pathways
csg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cylst_0973
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cylst_0973
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Cylst_0973
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csg01011]
    Cylst_0973
Enzymes [BR:csg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Cylst_0973
Peptidoglycan biosynthesis and degradation proteins [BR:csg01011]
 Precursor biosynthesis
  Amino acid ligase
   Cylst_0973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Pneumo_ncap
Motif
Other DBs
NCBI-ProteinID: AFZ23297
UniProt: K9WUT8
LinkDB All DBs
Position
1132745..1133824
Genome map
AA seq 359 aa AA seqDB search
MAKLRVGLLFGGRSGEHEVSISSARAIANALSAEENADKYEIVPFYIQKDGFWQAGEVAQ
QVLDSGVAIENSAVTPNLWQFPAQASEIELWFPILHGPNGEDGTIQGLLSLMQVPFVGSG
VLGSATGMDKIGMKVAFAQAGLPQVKYQALTRSQIWSNPCVFPKLCDQIEAELGYPCFVK
PANLGSSVGIAKVRSRSELEAALDNAASYDRRIIVEAGVVAREVECAVLGNDQAQASIVG
EITFDSDFYDYETKYTQGKADLLIPAPLPEGIIQRIQEMALLAFAAVDAAGLSRVDFFYV
EATGEILINEINTLPGFTATSMYPQLWAQTGIPFAKLVDQLIQFALLRHSGEQPREDIQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctaaactacgggtgggcttgctgtttggtggacgttctggtgagcatgaagtttct
ataagttcagcaagagcgatcgcaaatgccttaagtgcagaggaaaatgctgataagtac
gaaattgtccctttttatatccaaaaggatggtttttggcaagctggggaagtcgcacaa
caagttttagactccggtgttgctattgaaaattcggcggtaactcctaatttatggcaa
tttcccgcacaagcctcagaaatagaactttggtttccgattctccacgggcctaatggt
gaagacgggacaattcaagggttactcagtttgatgcaagttccctttgttggttctggg
gtgttgggttcggctacggggatggataaaatcgggatgaaggtggcttttgctcaagct
ggacttccccaggtgaaatatcaggcattaacgcgatcgcaaatttggtcaaatccttgt
gtgtttccgaaactctgcgatcagatagaagctgaattgggctatccctgttttgtcaaa
cctgctaacttgggttcatcggtgggtattgctaaagtgcgatcgcgttctgaattagaa
gcagccttagataacgccgctagttatgacagaaggataattgtcgaagctggtgttgtc
gctagagaagtggaatgtgccgttttaggcaatgatcaagctcaagcttcgatcgtcggc
gagattacttttgatagcgatttttatgattatgaaactaaatatactcaaggtaaagcc
gatttattgattcccgcacccctcccagaggggattattcagcgaattcaagaaatggct
ttgctcgcttttgctgcggttgacgctgctgggttgtcaagagtggacttcttttatgtg
gaagctacaggggaaattttgattaacgaaatcaatactttaccaggtttcactgctacg
agtatgtatccccaactctgggcccagactggcattccctttgccaaattagttgatcag
ttgattcaatttgctctcttaaggcattctggggagcaaccaagagaagatatccagtaa

DBGET integrated database retrieval system