KEGG   Cylindrospermum stagnale: Cylst_1008Help
Entry
Cylst_1008        CDS       T02398                                 

Definition
(GenBank) WD domain, G-beta repeat-containing protein,protein kinase family protein
Organism
csg  Cylindrospermum stagnale
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase WD40 Pkinase_Tyr ANAPC4_WD40 eIF2A PQQ_2 Coatomer_WDAD Nup160 APH RIO1 YrbL-PhoP_reg Kdo Choline_kinase
Motif
Other DBs
NCBI-ProteinID: AFZ23328
UniProt: K9WSY4
LinkDB All DBs
Position
complement(1171315..1173312)
Genome map
AA seq 665 aa AA seqDB search
MSYCFNPNCQQPQNEPEILVCLNCGSPLLLSHANTSVYRGLKLIGQGGFGRTFLAVDESQ
PLKPRCAVKQFFALNSNFVTPEIKAKLINSEVEQLQRLDTHPGIPKFLGYLEQDGNHYLI
QEFIDGVNLAQELAEIGNLDEAKIRQVLQSILSVLDFIHSQQVIHRDIKPENIIRRRTDD
QLILVDFGAAKFVTGANLAQTGTVIGSPKYAAPEQVFGKASFSSDIYGLGVTCIFLLTGV
DPFELYAFAEDRWVWQDYLPSPVSSSLSRILDKMISRAINQRYQLAAAVIADLKPGLISV
ANNENTLLATVANQPSNVILSISKTGLQLQPDKWNCILDLETNIFSPGYTTIDLSADGKI
LAIAGRDCVEVWRLDTQTLVSSFEVRNAKISMSSDGQILVSNNIVLQETDGPGTKVWHIP
SKNLIRGLETNLLVSQSMSLSPDCRTLAFGGVGGRIHIWDLSTGKRLHKISGHSGWFKFY
PAVTSLIYLPKSVRIPELTALLEINKNTIQPSSSSQLLASASFDKTIKIWDVDTGKLLKT
FSHPSTTIAVTPDGKMLVSGSSDKTIKFWDLSSGELVRNFSVSGRVSKIVISPDGQSLVA
GGGDNKEGAMLVILDMVTGNILANLEGHQTRVCGLKMSSDGKVLVSQGGKVEVNSNSQLK
IWQLY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgagttactgctttaatcctaactgtcaacaaccccaaaatgagcctgaaatattagtg
tgcctgaattgtggctcacctcttttgctgagtcatgcaaatacttcagtttatcgaggg
ctaaaactaattggtcaaggtggttttggcagaacttttttagcagtagatgagtctcaa
ccactaaaaccccgttgtgcagtcaagcagttttttgctctcaactctaattttgtcact
cctgaaattaaagctaaactaattaattctgaagttgaacaactccaaagactagacact
catccagggattcctaaatttttgggatacttagagcaagatggcaatcattacttaatt
caagagtttattgatggagtaaatctagcacaggaattagctgaaatcggtaaccttgac
gaagctaaaattcgtcaggtactgcaaagtattttgagtgtcttggattttattcattct
caacaggtaattcaccgtgatatcaaaccagaaaatattattcgtcgtcgcactgatgac
caactaattctagttgattttggagcagctaaatttgtcaccggagctaacttagctcaa
actggtacagtaattggtagtcccaaatatgcagcaccagaacaggtatttggtaaagca
tctttttctagtgatatttacggtttaggggttacttgtattttcctgctcactggtgta
gacccttttgaattgtacgcttttgcagaagaccgctgggtttggcaggattatttacct
tctcctgtgagttcttctttgagtcgcattctagacaaaatgattagtagggcaattaat
caacgctatcaattagctgcggctgtgatagctgatttaaaaccaggtttaatctcagtt
gctaataatgaaaatactctattagctactgtcgctaatcaaccatcaaatgttatctta
tcaatatcaaaaacaggtttacaacttcaacctgacaaatggaactgtattctagacttg
gagacaaatatattctcaccaggttacaccacaattgatttgagtgcagatggaaaaata
ctagctattgctggcagagattgtgttgaagtatggcgtttggatactcaaacactagtt
tctagttttgaggtgagaaatgcaaaaatttctatgagttctgatggacagatattagtt
agtaataatattgtacttcaagagacagatgggcctggtaccaaggtatggcatatacct
agtaaaaacttaattcgtggtttagagaccaatttgttagtgagccagtctatgagcctg
agtcctgattgtcgtactctagcgttcggtggtgtaggggggagaattcatatttgggat
ttatcgacaggaaaacggctgcataaaatctctggacatagcggttggtttaagttttat
cctgctgtcaccagtctaatttatttgcctaagtccgtccgaatacctgagttaactgca
ctgctagaaattaacaaaaatacgattcaaccatcatcctctagtcagcttttagctagt
gccagttttgataaaactatcaagatttgggatgttgataccggaaaattgctgaaaact
ttttcacatccttctacaacaatcgctgtgactcctgatggcaaaatgctggtgagcggt
tcttcagataaaactattaaattctgggatttatctagtggtgaattagtgcgaaatttc
tccgtttctggtagggtatctaagatagttataagtccagatgggcaaagtttagtagca
ggtggtggagataataaggagggtgcgatgttggtaattttagacatggtgacaggaaat
atcctcgctaatttggagggacatcaaaccagagtatgtggtttaaagatgagcagtgat
ggcaaggtcttggtgagtcaaggtggaaaggttgaagtcaattcaaactctcaattaaaa
atctggcaactctattag

DBGET integrated database retrieval system