KEGG   Cylindrospermum stagnale: Cylst_3705Help
Entry
Cylst_3705        CDS       T02398                                 

Definition
(GenBank) exonuclease SbcC
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
csg  Cylindrospermum stagnale
Brite
KEGG Orthology (KO) [BR:csg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:csg03400]
    Cylst_3705
DNA repair and recombination proteins [BR:csg03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cylst_3705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SMC_N Rad50_zn_hook SbcCD_C AAA_15 AAA_29 AAA_21 ABC_tran RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AFZ25828
UniProt: K9X036
LinkDB All DBs
Position
4205436..4208462
Genome map
AA seq 1008 aa AA seqDB search
MIPVQLILKNFLSYRDATLDFRGLHTACICGSNGAGKSSLLEAITWAIWGESRATAEDDV
IYSGAKEVRVDFTFHNNQQKYRVIRTRLRGASGVLEFQIETPSGFRSLTGKGVRATQDVI
IQHIKLDYDTFINSAYLRQGRADEFMLKRPTERKEILAELLKLNQYDELEERAKDSSKQF
KFRVEDLERSLEAIKIQLQQRETTEAQRIELEAELNQLQQVQAFDNIQLQNLQVVQHQRQ
NWEQQLSFVRQQFQNLTQDCDRLQQEQLAVKTQLADLEEILHQEAEIQAGYTEYQNLQSQ
EEAFAAKFAQHTQATGLRQLKQQQLTKQINDIERQLQQAQAQLEALEQQEREIQQTLTKS
GDVEAALAQLAAARNHVAHLDQLQMQVSPLLQQRVTLQSQLDRTHASLVARLEQLQSTEN
QLQRQHRRQPQLQQAVIDVGVQIEELEKKRVYLQRVQEKGQERRHFIERLRATQGDYEKV
LGELEQKLQMLQNPNALCPLCERSLDEHHWSRVIEKTQLEYQDTQGQFWVVREQMAVSDR
EIQVLRQEYREISQQLAAYDALREQRGQLAAQLEATTDVQQQLQQIVAEKEHLERSLQAG
DYAPDKQAELRQLDEYLQQLNYNEQDHALARSEVERWRWAEIKLQQIKDATKRRATLTAR
KPELQANIAQFQTRIQQEQIDSDCARQIAALERQITEIAYSSEQHNHLRQSVRELQSWHL
RYQQMLSAQQQYPQLQARLQELQESQTARLAERQKLAHQIESIVQQLTQTDNPSAQIQAL
EQQLATRRRQLDEQIAKLGRLEQLAHQLETQQVEYEQQQQQLQYCKQQYRVYQELSQAFG
KNGIQALMIENVLPQLEAETNQLLSRLSGNQLHVQFVTQKAGRSGKSSKKNAKLIDTLDI
LIADTRGTRAYETYSGGEAFRINFAIRLALAKLLAQRVGAALQLLIVDEGFGTQDAEGCD
RLIAAINAIANDFACILTVTHMPHLKEAFQARIEVNKTQQGSQLLLSV
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgatcccagtacaacttatcctcaaaaacttcctcagttaccgtgatgcaactttagat
tttcgcggtttgcacacggcctgtatttgcggttccaatggtgcgggtaaatcttctctg
ctggaggcaatcacttgggcaatttggggcgaaagccgcgctactgctgaagatgatgtg
atctattctggcgcgaaagaagttcgggttgatttcactttccataataaccaacaaaaa
tatcgggttattcgtacccgtctccggggtgcaagtggcgttttagaatttcaaatagaa
acgccttctgggtttcgttcgctcactggcaaaggggtgcgagcaacacaggatgtgatt
atacaacatatcaaactagattacgatacttttattaattctgcctatctgcgtcaaggt
agagctgatgaattcatgctaaagcgtccgacggaacgcaaggaaattttagcggagttg
ttgaagctgaatcagtatgatgaattagaagaacgggcaaaggacagttctaaacagttc
aaattcagggtggaggatttagagcgttctttagaggcgattaaaattcagctacaacaa
cgggagacaactgaggcgcaacgaatagagttagaagctgaactgaatcaactgcaacag
gtgcaagcttttgacaatattcaattacaaaatttgcaagttgtgcagcatcagcggcaa
aattgggaacaacaactgagttttgtgaggcagcaattccagaatcttacccaagattgc
gatcgcctccaacaagaacagttagcggtgaaaactcagctagcagatttagaagaaatt
ttacatcaagaagccgaaattcaagctggatataccgaataccaaaatctgcaatctcaa
gaagaagcctttgctgccaaatttgcacaacatacccaagccactggtttacggcaacta
aaacaacaacagcttaccaaacaaattaacgacattgaaaggcaactgcaacaggctcaa
gctcaattagaagctttggagcaacaagagcgagaaattcagcaaactctcactaaatct
ggtgatgtggaagcggctttggcacaattagccgctgcgcgtaatcatgtagcgcatttg
gatcaactgcaaatgcaagttagtcccttgttacaacaacgggtaactttacaaagccaa
ctagatcgcacccatgcgagtttggtagcgcgactcgaacaactgcaatctacagaaaat
caactacaacgccaacatcgccgccaaccgcaactccagcaagcggtgatcgatgtggga
gtgcagattgaggaattggagaaaaagcgggtttatctgcaaagagtccaagaaaaaggg
caggaacggcgtcattttatcgaacgcttgcgagcgactcaaggggattatgaaaaagtg
ctgggtgaattagaacaaaaactgcaaatgctccaaaaccctaatgccctttgtcccttg
tgtgaacgttctttagatgaacatcactggagccgagtgatcgaaaaaacccaacttgag
taccaggatactcaggggcaattttgggtagtgcgggaacaaatggcggtttcagataga
gaaattcaggtactcaggcaggaatacagagaaatatcccaacaattggcggcttatgat
gctttgcgggaacaacggggacagttagcggcacagttagaagcaacaacggatgtgcaa
caacagctgcaacaaattgttgctgaaaaagaacatttagagcgatcgctccaagctggt
gattatgcccctgacaaacaagcagaactccggcagctagacgaatatctgcaacaactc
aattacaatgaacaagaccacgccctggcccgcagcgaagttgagcgatggcggtgggca
gaaattaaacttcagcaaattaaagatgctaccaagcgccgcgccacactaacagcccga
aaacccgaactccaagcgaatattgcccaatttcaaacgagaattcagcaagagcaaatt
gattctgattgtgctagacaaatcgctgccctagagcggcaaattaccgaaattgcttac
agttccgagcaacacaatcacctccgccaatctgttcgtgagcttcaatcttggcatttg
cgttaccaacaaatgttgtctgctcaacagcaatatccccaactccaggcaagattgcaa
gagttgcaggagtcccaaactgccagattagcagagcggcaaaaactcgctcaccaaatc
gaaagcattgtccagcaactcacccaaacagataatccatcggcccaaattcaagcttta
gagcagcaattggcaacccgcagacggcaacttgatgagcaaatagccaagttggggcgt
ttggaacaactggctcaccaattagaaacgcagcaagttgagtatgagcaacagcagcag
caactgcaatattgcaagcagcaatatcgtgtttatcaggaattgtcccaagccttcggt
aaaaatggcatccaagcactgatgattgaaaatgtgttaccccaactagaagccgagaca
aatcaactactttcgcggctgagtggtaatcagttgcatgtgcaatttgtgacgcagaaa
gctgggcgcagtggcaagtccagcaagaaaaacgccaagctgatagacactttggatatt
ttaattgctgataccagaggtacgcgagcttatgaaacttactctggtggggaagctttt
agaattaactttgctatccgtttggctttggcgaaattattggcccagagggtgggagcg
gctttgcaattattgattgtggacgaagggtttggcacacaggatgcggaaggatgcgat
cgcttaattgccgctataaatgcgatcgctaacgatttcgcctgcattctcaccgtcacc
catatgccccacctcaaggaagccttccaagcccggattgaagtcaataaaacccagcaa
ggttcgcaattgcttctgtctgtttaa

DBGET integrated database retrieval system