KEGG   Cylindrospermum stagnale: Cylst_3919Help
Entry
Cylst_3919        CDS       T02398                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00500  Starch and sucrose metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cylst_3919
Enzymes [BR:csg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Cylst_3919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFZ26031
UniProt: K9X1W0
LinkDB All DBs
Position
complement(4433468..4436032)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPSRLEPLRRLAYNLHWDWNVETKDVFRRLDPDLWESSHHNPVLMLGT
ISQGRLLEVVEDEGFLAQMDRANRQLEDYLQERTWYQKQRGQDAKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYLMNDFYNM
PLHLERNADGSELRIAVNYPGRKVYARVWRVQVGTVPLYLLDTNIEPNNAYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYDVTAYHMNEGHAAFSALERIRTLIQQDGLSYAQ
ARQVVSSSNIFTTHTPVPAGIDLFSPDKILYYLGYYADIFGLPKEQFLGLGRENTGDLSA
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPIAAITNGVHARSCVAKA
TQELYDRYLGPNWSSAPPDSQLWERMDAIPDEELWRNHERCRLDMILYVREHLVKHLRDR
GASASEIAQAQEVLDPNVLTVGFARRFATYKRATLWMRDLDRIKQILLGNKDRKVQFVIA
GKAHPKDIPGKELIRDINHFIREQHLEKQVVFVPNYDIHIARLLVAGCDIWLNTPRRPRE
ASGTSGMKAAMNGLPNLSVLDGWWDEADYVRTGWPIGHGENYEDPNYQDEVEANAFYDLL
EKEVAPLFYDHRDGDGLPRPWVAKMKNAIRLNCPFFNTARMVREYAERAYFPASDRYHTL
ITENYAPAKELAAWKSKLADHWFNIKVKDIDVSAASDIEVNQTVSVKAKVDLSVLTNDDV
QVELYQGAIDAHGEIVNAKPVVMDYQGNDAQGLSIYTANITYTSSGLQGLSLRVLPKHPY
LSSSYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaattcgcacattcaatgtctctccttcactaccgtcgcgactagaacccctg
cggcgattagcatacaatctacactgggattggaatgttgagactaaagatgtatttcgc
cgcttagacccagacctgtgggagtctagccatcataacccggtgttgatgctcggtact
atcagccaaggacggcttttggaggttgtggaagatgaaggcttcctggcgcaaatggat
cgcgctaaccgtcagttagaggattatcttcaagaacgcacctggtatcagaaacaacgc
ggccaagatgcaaaagaatgctacgcctatttttcggctgaatttggtcttgtagattgt
ttacctgtgtattctggtggtttgggtgttctggcgggggatcacctcaaatctgctagt
gacttgggactaccgttggttggtgttggcttactgtaccagcaaggctactttgctcag
tatctgaatgctgatgggtggcagcaagagcgctacctgatgaacgatttctacaatatg
cctttgcacctagagcgcaatgctgatggttctgaattgcggattgcggtaaattatcca
ggacgcaaggtatacgctagagtttggcgcgtacaggtgggaacggtgcctctgtatttg
ttggataccaacattgaacccaacaacgcttatgaccacgacattacagaccagctgtat
ggtggggatatcgatatgcgtatccaccaagaaattatgctgggtattggtggtgtacag
atgctcaaagcgttgggttatgatgtcaccgcttatcatatgaatgaaggtcacgcggcg
ttctcggctctagagcgcatccgcactttgattcagcaagatggtttgagttatgcccaa
gctagacaggttgtgtcttctagtaatatctttaccacccacacaccagttccagcgggt
attgatttgttctctcctgacaagattttgtactacctaggatactatgcagatatcttt
ggtttgcctaaagagcagtttttaggtttgggacgagaaaatactggggatttatctgcg
cctttcagtatggcggtgttagcgctgaagatggcgacattttctaatggtgtggcgcaa
ctgcatggtgtggtgtcacggcagatgtttcagggtttgtggaagaaggtgcctgtagag
gaagtgccgatcgctgctattactaatggtgtacatgctcggagttgcgttgctaaagcg
actcaggagttgtacgatcgctatttaggtccaaattggtcatcggcaccaccagatagt
cagttgtgggaacggatggacgccatacctgatgaggagttatggcgcaatcatgaacgc
tgccgcttagacatgattttgtatgtgcgggagcatttagttaaacatttgcgcgatcgc
ggcgcttctgcctcagaaattgctcaagctcaagaagttctcgatcctaacgtgttaact
gtgggctttgctcgtcgttttgctacctacaaacgcgctaccctatggatgcgcgattta
gaccggatcaagcagattttgctggggaataaagaccgcaaagtccaatttgtcatcgct
gggaaggcacacccgaaagatattcccggtaaagaactgatccgcgatatcaatcacttt
atccgcgaacaacacttagaaaaacaagtggtgtttgtgcctaattacgatattcacatc
gctcggttgttggtggctggttgcgatatctggttaaatacaccacgtcgtccacgggaa
gcttctggtaccagtggcatgaaggcagcgatgaatggattgccgaatttaagcgtccta
gatggctggtgggatgaggctgattatgtccgcaccggttggccgattggacatggtgag
aattacgaagatcctaattaccaggatgaagtggaagccaacgctttctatgatttgctg
gagaaggaagttgcaccgctattttatgaccatcgggatggtgatggcttgcctcgtcct
tgggtggctaaaatgaagaatgctatccgcttaaattgtccgttttttaatacagcgcgg
atggtgcgtgaatatgctgaacgggcttacttccccgctagcgatcgctaccataccctc
attaccgaaaattacgccccagctaaggaattggcggcttggaagtcaaaattagctgat
cactggtttaacatcaaagttaaagatattgacgtatcggcggcttcagatattgaggtt
aaccaaactgtgtctgtcaaagccaaggttgatttgtcggttttgactaatgatgatgtg
caggtggagctataccagggtgcaattgatgctcatggtgaaattgtcaatgccaagccg
gtggtgatggattatcaaggaaatgatgcacaaggattgagtatttacacggcgaatatc
acctataccagttctggtttacaaggtttgtctttgcgcgtgttaccaaaacatccatac
ttgtctagttcttatgaacctaggttgattgcttgggctgagtaa

DBGET integrated database retrieval system