KEGG   Cylindrospermum stagnale: Cylst_4775
Entry
Cylst_4775        CDS       T02398                                 

Name
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00010  Glycolysis / Gluconeogenesis
csg00020  Citrate cycle (TCA cycle)
csg00620  Pyruvate metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
csg01200  Carbon metabolism
Module
csg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_4775
   00020 Citrate cycle (TCA cycle)
    Cylst_4775
   00620 Pyruvate metabolism
    Cylst_4775
Enzymes [BR:csg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cylst_4775
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Aminotran_1_2 AATase GCV_H
Other DBs
NCBI-ProteinID: AFZ26835
UniProt: K9X2G1
LinkDB
Position
5413526..5414842
AA seq 438 aa
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
LVPAGETAPVGSAIAFIAETEAEIATAKSLANSGDAAATPVSSPAPVAATATVATPASQN
GSNHREGRVVVSPRARKLAKELKVDLNTLKGSGPYGRIVAEDVEGTVKKDKPPAAVTPAP
VPTPTVIPVAPPAPPAPSTPAPAPAATPAISSSVAGQVVPLTTLQNAVVRSMVASLSVPV
FRVGYTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVHHSDIN
ISVAVAMDDGGLITPVLQNADIVDIYSLSRTWKSLVEKARAKQLQPQEYNSGTFTLSNLG
MFGVDTFDAILPPGQGSILAIGASRPQVVATADGLFGVRQQMQVNITADHRIIYGADAAA
FLRDLAKLIETNPQSLTL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggggacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgagggatatctggcccatatt
ttagtcccagcaggtgaaaccgcccctgtgggatcagcgatcgcctttatagcagaaacc
gaagctgaaatcgccactgctaagtccctagccaactcaggagacgccgctgcaacccct
gtctcatcccccgcacccgtcgctgccaccgcaacagtggcaacaccagcctctcaaaat
ggttctaatcaccgggaaggacgggtcgtagtttcaccccgcgcccgcaagttagccaaa
gaactcaaagttgatttgaatacccttaaaggcagtggcccctacggtcggattgtcgcc
gaggacgtggagggaactgtcaaaaaagacaagccacctgctgctgttaccccggcacca
gtacccactccaactgtcatcccagttgcaccgccagcacccccagcaccgtcaacacca
gcaccagcaccagcagccactccagcgatcagcagttctgttgctggtcaggtagtgcct
ctgactaccctgcaaaatgcagtagtcaggagtatggtggctagcctatctgtacccgtc
ttccgtgtgggttacacaattaccaccgatgggctagacaagctttacaagcagattaaa
tccaaaggggtgacgatgacagccctactggcaaaagccgtggcggtgacattacaaaaa
cacccactgctcaatgctagctactcagaccagggaattgttcatcattctgacatcaac
atttctgtagctgtggcgatggatgatggcggattaattacacccgtgttgcagaatgca
gacatagtcgatatttattctctatctcgtacttggaaatctttggtagaaaaagctaga
gctaaacaactacaaccccaagagtataacagcggcacttttactctgtcgaacttggga
atgtttggtgtggatacgtttgatgcgattttgccacctggacaaggttcaattttagcg
atcggcgcctcccgcccgcaagtggtagccacagccgacggtttatttggtgtgcgacaa
caaatgcaagttaatatcaccgctgatcaccggattatttacggtgctgatgctgcggca
ttcttgagagatttagcgaaattgattgaaacgaatcctcaatctttgacactttaa

DBGET integrated database retrieval system