KEGG   Cylindrospermum stagnale: Cylst_4775Help
Entry
Cylst_4775        CDS       T02398                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00010  Glycolysis / Gluconeogenesis
csg00020  Citrate cycle (TCA cycle)
csg00620  Pyruvate metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
csg01130  Biosynthesis of antibiotics
csg01200  Carbon metabolism
Module
csg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_4775
   00020 Citrate cycle (TCA cycle)
    Cylst_4775
   00620 Pyruvate metabolism
    Cylst_4775
Enzymes [BR:csg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cylst_4775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase Aminotran_1_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFZ26835
UniProt: K9X2G1
LinkDB All DBs
Position
5413526..5414842
Genome map
AA seq 438 aa AA seqDB search
MSINEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
LVPAGETAPVGSAIAFIAETEAEIATAKSLANSGDAAATPVSSPAPVAATATVATPASQN
GSNHREGRVVVSPRARKLAKELKVDLNTLKGSGPYGRIVAEDVEGTVKKDKPPAAVTPAP
VPTPTVIPVAPPAPPAPSTPAPAPAATPAISSSVAGQVVPLTTLQNAVVRSMVASLSVPV
FRVGYTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVHHSDIN
ISVAVAMDDGGLITPVLQNADIVDIYSLSRTWKSLVEKARAKQLQPQEYNSGTFTLSNLG
MFGVDTFDAILPPGQGSILAIGASRPQVVATADGLFGVRQQMQVNITADHRIIYGADAAA
FLRDLAKLIETNPQSLTL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcattaacgaagtatttatgccggcgctgagttccaccatgaccgaaggcaaaatt
gtctcctgggtgaaatcgccaggggacaaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgagggatatctggcccatatt
ttagtcccagcaggtgaaaccgcccctgtgggatcagcgatcgcctttatagcagaaacc
gaagctgaaatcgccactgctaagtccctagccaactcaggagacgccgctgcaacccct
gtctcatcccccgcacccgtcgctgccaccgcaacagtggcaacaccagcctctcaaaat
ggttctaatcaccgggaaggacgggtcgtagtttcaccccgcgcccgcaagttagccaaa
gaactcaaagttgatttgaatacccttaaaggcagtggcccctacggtcggattgtcgcc
gaggacgtggagggaactgtcaaaaaagacaagccacctgctgctgttaccccggcacca
gtacccactccaactgtcatcccagttgcaccgccagcacccccagcaccgtcaacacca
gcaccagcaccagcagccactccagcgatcagcagttctgttgctggtcaggtagtgcct
ctgactaccctgcaaaatgcagtagtcaggagtatggtggctagcctatctgtacccgtc
ttccgtgtgggttacacaattaccaccgatgggctagacaagctttacaagcagattaaa
tccaaaggggtgacgatgacagccctactggcaaaagccgtggcggtgacattacaaaaa
cacccactgctcaatgctagctactcagaccagggaattgttcatcattctgacatcaac
atttctgtagctgtggcgatggatgatggcggattaattacacccgtgttgcagaatgca
gacatagtcgatatttattctctatctcgtacttggaaatctttggtagaaaaagctaga
gctaaacaactacaaccccaagagtataacagcggcacttttactctgtcgaacttggga
atgtttggtgtggatacgtttgatgcgattttgccacctggacaaggttcaattttagcg
atcggcgcctcccgcccgcaagtggtagccacagccgacggtttatttggtgtgcgacaa
caaatgcaagttaatatcaccgctgatcaccggattatttacggtgctgatgctgcggca
ttcttgagagatttagcgaaattgattgaaacgaatcctcaatctttgacactttaa

DBGET integrated database retrieval system