KEGG   Clostridium saccharolyticum WM1: Closa_0528Help
Entry
Closa_0528        CDS       T01288                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00473  D-Alanine metabolism
csh00550  Peptidoglycan biosynthesis
csh01100  Metabolic pathways
csh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Closa_0528
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Closa_0528
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Closa_0528
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csh01011]
    Closa_0528
Enzymes [BR:csh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Closa_0528
Peptidoglycan biosynthesis and degradation proteins [BR:csh01011]
 Precursor biosynthesis
  Amino acid ligase
   Closa_0528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ADL03164
UniProt: D9R451
LinkDB All DBs
Position
595872..596936
Genome map
AA seq 354 aa AA seqDB search
MGRKTAVVLFGGQSSEHIVSCMSVVNVINHIDREKYEVALIGITEEGRWIKTDSVEDIET
GTWKNGTVSAVISPDATMGGIILLDGEKTEVLKADVVFPVLHGLLGEDGTVQGLLELARI
PYVGCGVLSSAVSMDKLYTKIIVDDLGVTQAAYVPVMRHDLKDMDLVVGKVEERFSYPVF
VKPSNAGSSKGVSRAEDRKELMEALTEAAVHDRKILVEEMIVGREIECAVFGGGNLPAEA
SGVGEILAAAEFYDFDAKYYNSDSRTVVDPVLPEGAAERVKEAAKAIFQAVDGYGLARVD
FFVKEDGSVVFNEINTMPGFTAISMYPMLWEAAGMNKDELVGRLMEHAMDRYRL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtagaaaaactgcggttgtattatttggcggccagtcatcagagcatattgtatcc
tgcatgtcggtagtcaatgtgattaaccatatagatagagaaaagtatgaggttgctttg
attggaatcacagaagagggccggtggatcaagacagattctgtagaagatattgaaacg
ggcacatggaaaaacgggaccgtttctgctgtcatttctcctgatgccactatgggaggc
ataatcttactggatggggaaaaaacagaagtacttaaggctgatgtggtattccctgtg
cttcatggacttctgggagaggatggaaccgtacaggggcttttagaactggcaagaatt
ccttatgtgggctgcggagtactgtcttctgctgtttccatggataaactatatacgaag
attattgtagatgacctgggagtcactcaggcggcctatgtaccggtgatgcgccatgac
ttaaaggatatggatttggtggtaggtaaggtggaggaaaggttctcttaccctgtgttt
gtaaagccctccaatgcaggctcatcaaagggtgtgagccgggcagaggatcggaaagag
cttatggaagccttgacggaggcagcggtccacgaccgcaagattctggtggaagagatg
atcgtaggccgggagatcgaatgcgctgtgtttggagggggaaatctgccggcggaagct
tccggggtaggagagatccttgctgcagcggaattttatgactttgatgccaaatattac
aactctgattccagaacagtagtggacccggtgctgcctgagggggctgcagaacgggtg
aaagaagctgccaaggcgattttccaggcagtggatggttacggcctggccagagtggac
ttttttgtaaaagaggacggcagtgtggtattcaacgagatcaataccatgcccggattt
acggccatcagcatgtatcccatgctttgggaagcggccggaatgaataaggatgagttg
gtgggccgtcttatggagcatgcgatggaccgttaccggttataa

DBGET integrated database retrieval system