KEGG   Clostridium saccharolyticum WM1: Closa_1559Help
Entry
Closa_1559        CDS       T01288                                 

Definition
(GenBank) anti-sigma-factor antagonist
  KO
K06378  stage II sporulation protein AA (anti-sigma F factor antagonist)
Organism
csh  Clostridium saccharolyticum WM1
Brite
KEGG Orthology (KO) [BR:csh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    Closa_1559
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2
Motif
Other DBs
NCBI-ProteinID: ADL04156
UniProt: D9R9V6
LinkDB All DBs
Position
1653223..1653564
Genome map
AA seq 113 aa AA seqDB search
MNQPYFTYEADGQTLIIHLPEELDHHNCSGLKYETDLILSENYIRRIVFDFSKTRFMDSS
GVGILLNRYKQMALSGGTVSLYGAGPQALRILKIGGILKLMKLYDSKEAAVTG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaccatactttacatatgaagcagatggacagaccttgattatccatctgccg
gaggagttggatcatcataactgttcagggcttaaatacgaaaccgatttaatcctttct
gagaactatatcaggcgcattgttttcgatttttcaaaaaccaggttcatggattcttcg
ggagtgggtattttgctgaacagatataagcagatggctttaagcggggggaccgtaagc
ctctacggagcaggtccccaggctctccgcattctaaaaatagggggcattttaaaatta
atgaaattatatgactctaaggaagcagcagtcacaggttga

DBGET integrated database retrieval system