KEGG   Clostridium saccharolyticum WM1: Closa_3255Help
Entry
Closa_3255        CDS       T01288                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
csh  Clostridium saccharolyticum WM1
Brite
KEGG Orthology (KO) [BR:csh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Closa_3255
Enzymes [BR:csh01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Closa_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C DAO Thi4 FAD_binding_3 K_oxygenase Thioredoxin_4 Glutaredoxin NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADL05784
UniProt: D9R8Q5
LinkDB All DBs
Position
complement(3500877..3502406)
Genome map
AA seq 509 aa AA seqDB search
MMLDAEIKKQLTEYLQLLENDVLIKISAGSDRVSKDMMDLIHELTGLSPRIKTEEGKLPR
TPSFSINRMGEDTGVTFAGIPLGHEFTSLVLALLQVSGRAPKVEGYLIDQVKRIQGEHHF
ETYISLSCHNCPEVVQALNLMSILNPGITHTMIDGAAFKDEAERKNVMAVPTVYLNGEVF
GSGRMTLEEILGKLGSAPDISEFEKKEPFDILVIGGGPAGASAAIYAARKGIRTGIVAER
FGGQVRETLGIENLISVAYTEGPEFAEILEQHVKNYEVDIMDSQRAVRLERKELLEVELE
NGAVLKSKAVILSTGARWRYVGVPGEAEFKNKGVAYCPHCDGPLYKGKQVAVIGGGNSGI
EAAIDLAGIAGHVTVLEFMPELKADSILQKRLYRLPNVTVIKNVQTKEITGTDKVNGISY
MDRETGEVHHQELQGVFVQIGLTANTDWLGETVARSPMGEIIVDHRNATNVPGVFAAGDC
TDSAYKQIVIAMGSGASAALSAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgatgctggatgctgaaattaaaaaacaactgactgagtatctccagcttctggaaaat
gatgtactgattaaaatcagtgcaggatctgaccgtgtatcaaaggacatgatggatctg
atccatgaactgaccggcctctctccaaggataaagacggaggagggtaagcttcccaga
acccccagctttagcattaaccgtatgggggaagacacgggagtgacgtttgcaggaatt
cctctgggtcatgaatttacttctctggtgctggctcttttgcaggtaagcggaagagcc
cccaaggtggaagggtatttaatcgaccaggtgaaacgcatacagggggagcatcatttt
gaaacctacatcagcttaagctgccataattgcccggaggtggtgcaggctcttaactta
atgagcattttaaatcccggtatcacccataccatgattgacggcgctgcttttaaagat
gaggcggaacgtaaaaatgtcatggccgttcctacggtatacttaaacggcgaggttttt
ggcagcgggcgcatgaccctggaagagatattggggaaattaggaagtgcccctgatata
tcagaatttgagaagaaagagccttttgatatactggtcatcggagggggccctgcagga
gccagtgcagccatttatgcggcgcgcaaaggcattcgcaccggtattgttgccgaacgc
ttcggcggtcaggtaagagagacgctggggatcgagaatctcatcagtgtggcatatacc
gaaggtcctgaatttgcagaaatcctggagcagcatgtaaaaaattatgaagtggatatt
atggattcccagcgtgccgtacgcctggaaagaaaagaactccttgaggtagagctggaa
aacggtgctgtcttaaaaagcaaggcagtgatcctatctacaggcgcccggtggagatat
gtgggtgtaccgggagaggcggaatttaagaataagggagttgcttattgtcctcattgt
gacggccccctttataaaggaaagcaagtggcagtcatcggaggcggcaattccggcatt
gaagcggcaattgatcttgctgggatcgccggccatgtgacagttcttgaatttatgcct
gagctgaaggcggattccattctccagaagcgtctttaccgtctgcccaatgtgacagtg
ataaagaacgttcagacaaaagaaattaccggcacagacaaggttaacggcatttcctat
atggatcgtgaaacaggagaagtccatcaccaggagctgcagggtgtgttcgttcagatc
ggccttacggccaatacggactggctgggagaaaccgttgcacgcagtcccatgggagag
attattgtggatcaccgcaatgccaccaatgtacccggagtttttgcggcaggagactgc
acggacagtgcttataaacagatcgttattgccatgggatccggagccagcgcagcttta
agtgcttttgactatttaataagaaattga

DBGET integrated database retrieval system