KEGG   Clostridium saccharolyticum WM1: Closa_3372
Entry
Closa_3372        CDS       T01288                                 

Definition
(GenBank) undecaprenol kinase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Closa_3372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csh01011]
    Closa_3372
Enzymes [BR:csh01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     Closa_3372
Peptidoglycan biosynthesis and degradation proteins [BR:csh01011]
 Precursor biosynthesis
  Diphosphatase
   Closa_3372
SSDB
Motif
Pfam: BacA
Other DBs
NCBI-ProteinID: ADL05899
UniProt: D9R9E8
LinkDB
Position
complement(3636565..3637398)
AA seq 277 aa
MNIIEILKVIVLGIVEGFTEWLPISSTGHMILVDEIIHLNQPTAFKNMFLVVIQLGAILA
VLVLYFDKLNPFSVRKKPVQKQATLILWSKIVLACIPAAVIGFLVDDILDEYLMNGYVVA
ATLILYGVLFIVIENRNQYRSFEVQKVGDISYQTALWIGLFQLLSLIPGTSRSGSTILGA
MILGCSRPASAEFSFFLGIPIMFGASFLKIVKYGLSFTGPQVFYLVLGMVIAFVVSVYSI
KFLMGYIRQHDFKFFGYYRIVLGAVVLLYFIITALLG
NT seq 834 nt   +upstreamnt  +downstreamnt
atgaatatcattgagattttaaaagtaatagtattgggaattgtggagggctttacggag
tggcttcccataagcagtacgggtcacatgatccttgtggatgaaattatacacttaaat
cagcccacggcttttaaaaatatgtttctggtagtgatccagctgggagccattttagca
gtgctggtcctgtattttgataagctcaatcccttttctgtcaggaaaaaaccggttcag
aagcaggctaccctgatattatggtccaaaatcgttttagcctgcatccctgctgcagtg
attggatttctggtggatgacatccttgatgaatatctgatgaacggttatgtggtggca
gcgaccctgatcctctatggcgtattatttatcgtcattgagaacaggaaccagtaccgg
agctttgaagttcagaaggtgggggacatctcttatcaaacggctctctggattggctta
ttccagcttttgtccctgattccgggtacttcccgatcgggttccaccattttgggagcc
atgatcttaggatgctccaggccagcctccgcagagttttccttttttctgggaattccc
atcatgtttggagccagctttttaaagatcgtgaaatatggactgagttttacaggacct
caggtattctatttggttttaggcatggtgatagcttttgtggtttctgtttattctatt
aagtttttaatgggatatatcagacagcatgattttaaattcttcggatattacagaatt
gttctgggagcagtggtgcttttgtactttatcattacggcactccttggttaa

DBGET integrated database retrieval system