KEGG   Clostridium saccharolyticum WM1: Closa_3780Help
Entry
Closa_3780        CDS       T01288                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
csh  Clostridium saccharolyticum WM1
Brite
KEGG Orthology (KO) [BR:csh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:csh03012]
    Closa_3780
   03029 Mitochondrial biogenesis [BR:csh03029]
    Closa_3780
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csh04147]
    Closa_3780
Translation factors [BR:csh03012]
 Eukaryotic Type
  Elongation factors
   Closa_3780
 Prokaryotic Type
   Closa_3780
Mitochondrial biogenesis [BR:csh03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Closa_3780
Exosome [BR:csh04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Closa_3780
  Exosomal proteins of breast cancer cells
   Closa_3780
  Exosomal proteins of colorectal cancer cells
   Closa_3780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ADL06300
UniProt: D9QZS4
LinkDB All DBs
Position
complement(4081334..4082527)
Genome map
AA seq 397 aa AA seqDB search
MAKAKFERNKTHCNIGTIGHVDHGKTTLTAAITKTLHERLGTGQAVAFENIDKAPEERER
GITISTSHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGVMAQTREH
ILLSRQVGVPYIVVFMNKCDMVDDAELLELVDMEIRELLNEYEFPGDDTPIIQGSALKAL
EDPSSSWGDKVLELMAAVDEWIPDPVRETDKPFLMPIEDVFSITGRGTVATGRVERGTLH
VSDEVEIVGIHEETRKVVVTGIEMFRKLLDEAQAGDNIGALLRGVQRTEIERGQCLVKPG
SVKCHKKFTAQVYVLTKDEGGRHTPFFNNYRPQFYFRTTDVTGVCDLPAGTEMCMPGDNV
EMSVELIHPVAMEQGLRFAIREGGRTVGSGRVVTIVE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagctaagtttgaaagaaacaaaacccattgtaacattggtaccatcggtcac
gttgaccacggcaaaactactttaacagctgctatcacaaagactcttcatgaaagatta
ggtactggacaggcagtagctttcgagaatatcgataaggctccggaagagagagagcgt
ggtatcaccatttctacttcccacgttgagtatgagacagagaagagacactatgcacac
gttgactgcccaggacatgctgactacgttaagaacatgatcactggtgctgcacagatg
gatggcgctatcttagttgtagctgctaccgatggtgttatggctcagacaagagagcac
atcctgctttcccgtcaggtaggcgttccttacatcgttgtattcatgaacaagtgcgat
atggttgacgatgcagaattacttgaattagtagatatggaaatccgtgagctgttaaac
gagtatgaattcccaggcgatgatacaccaatcatccagggttctgctttaaaggctctt
gaagatccttccagctcttggggcgacaaggttcttgaattaatggcagcagtagatgag
tggattccggatcctgtacgtgaaacagataagccattcttaatgccaatcgaggacgtt
ttctctatcacaggccgtggtactgttgctaccggtagagtagagcgcggtactttacac
gtatctgatgaagttgaaatcgttggtattcatgaagaaacacgtaaggttgttgtaacc
ggtatcgaaatgttccgtaagctgcttgacgaagctcaggctggtgataacatcggtgca
ttacttcgtggtgttcagagaactgaaatcgaaagaggacagtgtctggttaagccaggt
tctgtaaagtgccacaagaagtttaccgcacaggtttacgttttaacaaaagatgaaggc
ggacgtcatactcctttcttcaacaactacagacctcagttctatttcagaacaactgac
gttaccggcgtttgcgatttaccagctggcacagaaatgtgtatgcctggcgataacgta
gaaatgtctgttgagctgattcatccagtagctatggagcagggtcttcgtttcgcaatc
cgtgaaggcggccgtaccgttggttcaggcagagttgttactatcgttgaataa

DBGET integrated database retrieval system