KEGG   Clostridium saccharolyticum WM1: Closa_4264Help
Entry
Closa_4264        CDS       T01288                                 

Definition
(GenBank) extracellular solute-binding protein family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:csh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Closa_4264
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csh02000]
    Closa_4264
Transporters [BR:csh02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    Closa_4264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_11 SBP_bac_1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ADL06764
UniProt: D9R3P3
LinkDB All DBs
Position
4611109..4612197
Genome map
AA seq 362 aa AA seqDB search
MKKTAKISAVLLAMALAATGCSSGKPADNNTAADTGKTQAAAQTPGEEDPVLVVYTARGE
SLNNAVIPEFEKDTGIKVEVVVAGTGELLKRAQSEKANPLGDIFWVADQTMLSASKDLFL
EYVSSENDNMIDAFKNTTGYFTPAFADPTVMIVNKDLKGDTKIDGFEDLLNPELKGKIAF
GDPVNSSSAFQSLLAMLYGMGKDGDPLSDEAWAFVDKFIANLDGKMCNSSSQVYKGVAEG
EYVVGLTWEDPAANYVKEGAAVEVVFPAEGAIFPGESVQILKDCKHPENAKKFVDYMLSE
KIQNAVGSTLTVRPLRKDTTLADYMKPQNEIKLFDNYDEGWVAEHKLEITNRFSEHLETS
MD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaacagcaaaaatatcagcagtcttattagccatggcactggcagccaccggc
tgcagctctggaaaaccggctgataataacacagcggctgacacgggaaaaactcaggct
gccgctcagacaccaggagaggaagatccggttttggtagtctataccgcccgcggcgaa
tctttaaacaatgccgtgattccggaatttgaaaaggacaccggcattaaagtcgaggtg
gtagtcgccggcaccggcgagctgttaaaaagagctcagtcagaaaaagccaatcctctt
ggcgatatcttctgggtggctgaccagaccatgttatccgcatccaaagacctgttcctg
gaatacgtatcctctgaaaatgacaacatgatcgatgccttcaagaataccaccggttac
tttacccctgcatttgcagatcctacggttatgatcgtaaacaaagacttaaaaggcgat
acgaagatcgatggatttgaggatttattaaatccggagttaaagggaaaaatcgcattt
ggcgatccagtaaactccagttccgcgttccagtcattgctggctatgctttatggcatg
ggcaaagacggggatcccctttcagacgaagcttgggcttttgttgacaagttcattgcc
aacttagacggtaaaatgtgcaacagctccagccaggtgtataaaggcgtggctgagggc
gaatatgtggttggtttaacctgggaagatcctgctgccaactatgttaaggagggtgcc
gcagtagaagttgtattcccggcggaaggagccatcttccccggagaatctgtccagatt
ctaaaagactgcaaacacccggaaaatgcaaagaaatttgtagattatatgctgtcagag
aagatccagaatgctgtcggttccacactgaccgtacggcctttaaggaaagacaccact
ctggctgattatatgaaacctcaaaatgagattaaattatttgataattatgatgaggga
tgggtagcagagcacaaattagaaatcaccaatcggttcagtgagcacctggaaacatcc
atggattaa

DBGET integrated database retrieval system