KEGG   Chryseobacterium shandongense: EG350_09895Help
Entry
EG350_09895       CDS       T05920                                 

Definition
(GenBank) biotin/lipoyl-binding protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csha  Chryseobacterium shandongense
Pathway
csha00010  Glycolysis / Gluconeogenesis
csha00020  Citrate cycle (TCA cycle)
csha00620  Pyruvate metabolism
csha01100  Metabolic pathways
csha01110  Biosynthesis of secondary metabolites
csha01120  Microbial metabolism in diverse environments
csha01130  Biosynthesis of antibiotics
csha01200  Carbon metabolism
Module
csha_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EG350_09895
   00020 Citrate cycle (TCA cycle)
    EG350_09895
   00620 Pyruvate metabolism
    EG350_09895
Enzymes [BR:csha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EG350_09895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C DUF2254
Motif
Other DBs
NCBI-ProteinID: AZA57476
UniProt: A0A3G6MWA6
LinkDB All DBs
Position
2187129..2188742
Genome map
AA seq 537 aa AA seqDB search
MAEVITMPRLSDTMTEGKVAKWHKKVGDKVKEGDILAEIETDKAVQDFESEVEGTLLYVG
VEEGGAAAVDSVLAIIGNEGEDISGLTGGEAPKSNDSEEKKVDEDHKTENNATSIEQTDA
EVPAGVEVITMPRLSDTMTEGKVAKWHKNVGDTVKEGDLLAEIETDKAVQDFESEFNGVL
LKQGVEEGGAAPVDSVLAIIGPEGTDVSGVGAPKAATSSEKPAEQKTETKEEEKAVPAAN
SSSSERVAISPLAKKMAQDKGVDINSIQGSGENGRIVKKDIENYQPSAAKPAASAPAASP
AAAQVALSFVQGEDTETPNSQVRNVIAKRLSESKFTAPHYYLMVEINMDKAIEARKEINS
LPDTKISFNDMIIKATAVALRKHPQVNSSWAGDKIIHRGNINIGVAVAIPDGLVVPVLKN
TDQMNYTQISAAVKDMAARAKNKGLKANEMEGSTFSISNLGMFGIETFTSIINQPNSAIL
SVGAIIEKPVVKNGQIVVGNIMKLSLACDHRVVDGATGAQFLQTLKTYLENPLTLLL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattacaatgccacgtctttccgatacaatgacggaaggaaaagtggct
aaatggcataaaaaagtaggggataaagtaaaggaaggcgatattttagcagaaattgaa
actgataaagccgttcaggattttgaatctgaagtagaaggaacccttttatacgttgga
gtagaagaaggcggagctgctgctgtagattccgtattggcaattatcggtaatgaaggt
gaagatatctcgggattaactggtggtgaagctcctaaatccaatgattctgaagagaaa
aaagtggatgaagaccataaaacagaaaataacgcaacaagtatagaacaaactgatgcc
gaagttcctgcaggagtggaagttattacaatgccaagactttccgatacaatgacggaa
gggaaagtggcaaaatggcacaaaaatgtaggtgataccgtaaaagaaggagatcttctt
gctgaaatcgaaaccgataaagccgttcaggattttgaatccgaattcaacggtgtactc
ttaaagcagggtgttgaagaaggcggagctgctccggtggattctgtattagcgatcatc
ggtcctgaaggtacagatgtttcaggagttggtgctcctaaagcggcaacttcatcagaa
aaaccggctgaacaaaaaaccgaaacaaaagaagaagaaaaagctgttccggctgcgaat
tcttcatcctcagaaagagttgccatctctccattagccaagaaaatggctcaggataaa
ggagtggatatcaacagtatccaaggctctggagaaaacggaagaatcgttaaaaaagat
attgaaaattaccagccttctgctgctaagccagctgcttcagctccggctgcaagtcct
gctgcggctcaggtagcattaagctttgttcagggtgaagatacggaaactccgaattca
caggtgagaaacgttatcgcgaaacgtctttctgaaagtaaattcaccgcacctcactat
tatctgatggttgaaatcaacatggataaggctattgaggcgagaaaagaaatcaactct
ttaccggataccaaaatttctttcaacgatatgatcattaaagcgacagctgttgcctta
agaaaacatccgcaggtaaattcaagctgggcaggtgataagatcatccacagaggaaac
atcaatatcggtgtagcagttgcaattcctgacggattggtggttcctgttcttaaaaat
acagaccagatgaactatacccaaatttctgctgcggtgaaagatatggctgcaagagct
aaaaacaaaggccttaaagctaatgaaatggaaggttctacattctccatctcaaacctt
ggaatgttcggtatcgaaacatttacaagcatcatcaaccagccgaattctgctatcctt
tcagtaggagctattattgagaagcctgttgtgaaaaacggacagatcgtggttggaaac
atcatgaagctttcattggcttgtgatcacagagtagtggacggtgctacaggagctcag
ttcttacagactttaaaaacgtatcttgaaaatcctttgacattgttactgtaa

DBGET integrated database retrieval system