KEGG   Chryseobacterium shandongense: EG350_17865Help
Entry
EG350_17865       CDS       T05920                                 

Definition
(GenBank) stearoyl-CoA 9-desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
csha  Chryseobacterium shandongense
Pathway
csha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csha00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    EG350_17865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csha01004]
    EG350_17865
Enzymes [BR:csha01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     EG350_17865
Lipid biosynthesis proteins [BR:csha01004]
 Desaturase
  Front-end
   EG350_17865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF2207
Motif
Other DBs
NCBI-ProteinID: AZA58934
UniProt: A0A3G6MT99
LinkDB All DBs
Position
complement(3968432..3969523)
Genome map
AA seq 363 aa AA seqDB search
MEKPIYLKDSEDAKLFNELRKKVNQRVEAIPENRDIYIQIKAIILPLLYFGLYVFALLHA
ENAGVYILSFVLMGLSLVLIYLNLIHEAAHNNIFKSKKLNSLVLQIFDFVGANSYIWKKR
HIASHHAYPNVDGWDTDIEQSGLLLIVPWIKAKGIQKYQHRFFFLVYPLYLFNWMFIRDF
RDFFDNDRVILKTQGAIPVKEKVKMIAYKLFYFFYQIAVPVLFFKVSIGLALGAWFLQVI
AASIFALFVLLPLHPLPDNAFPKLNEKNGLPFSWLHHQFEVTNDLKENNWFVRNVLGNFN
FHVAHHLFPNYSYAYYNEITEEIEEFARDHGLAYKRFPIATALGKHVDLLKQNANNAYFI
LEE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaacctatttacttaaaagattcagaggatgcaaaattatttaatgaattaaga
aaaaaagtgaaccagcgagtagaagcaattcctgaaaatcgggatatatacattcaaatc
aaagccattatactgcctttgctgtattttgggctgtatgtttttgctctgctacatgca
gaaaacgccggagtatacattttaagttttgttttgatgggattatctctcgtactcatt
tatttgaatctaattcatgaagcagcacacaataatattttcaaaagcaaaaaactcaac
agtctggtattgcagattttcgattttgtaggagccaattcttacatctggaaaaaaaga
catattgcaagccatcatgcgtatcctaatgtggatggatgggacaccgatattgaacaa
agcggtcttttattgatcgtcccatggataaaagccaaaggaattcagaaatatcagcat
cggtttttctttctggtttaccctttatatttattcaactggatgtttatcagggatttc
agggatttttttgataatgatagagtaatcctcaaaacgcagggagcaattcctgtaaaa
gaaaaagtgaaaatgattgcgtataaactgttttattttttctatcagattgctgttccg
gttttgttttttaaggtttcgataggtcttgctttgggagcatggtttctacaggtgatt
gcggcgagtatttttgcgctctttgtattgcttccattacacccgcttcctgacaatgct
ttcccgaagctgaatgaaaaaaatggattaccttttagctggttgcatcatcagtttgaa
gtaactaatgatttaaaagaaaataactggtttgtaagaaatgtgctgggaaatttcaac
tttcatgttgcccatcatcttttccccaattacagctatgcttattataatgaaattaca
gaagaaatcgaggagtttgcgagagatcacggattggcctataaaagatttccgattgcc
accgccttaggaaaacatgttgatttgctgaagcagaatgcaaacaacgcttattttatt
ttagaagaataa

DBGET integrated database retrieval system