KEGG   Cronobacter malonaticus CMCC45402: P262_00372Help
Entry
P262_00372        CDS       T02955                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00564  Glycerophospholipid metabolism
csi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    P262_00372
Enzymes [BR:csi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     P262_00372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_2 3HCDH_N Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHB68625
UniProt: V5TVC8
LinkDB All DBs
Position
complement(286312..287847)
Genome map
AA seq 511 aa AA seqDB search
MREGSSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLR
YLEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKR
TSLPGSTGLRFGSDSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVKKGGEVLTRTRATS
ARRENGMWIVEAEDIDTGETYTWQARGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHI
VVPRVHNQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKEVAIDESEISYLLK
VYNAHFKKQLGRDDVVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGK
LTTYRKLAEHAMEKLSSYYSNIGPAWTRNAVLPGGAFQGERDDYAAQLRRRYPFISETLA
RHYARTYGSNSELILGDAADINALGEHFGHEFYEAELRYLVEHEWVRRLDDAIWRRTKLG
MWLNGEEQSRVAQWLTENVGKKANVKLSLAS
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagggcagcagcatggaaaccaaagatctgattgtgataggtgggggcatcaac
ggtgccggtatcgcggcagacgccgcagggcgtggattatctgtgctgatgctggaagcg
caggatctggcgtgcgccacttcttccgccagctctaaattgatccacggcgggctgcgc
tatctggaacattacgagttccgtctggtcagcgaagcgctggccgagcgtgaagtgctg
ctgaaaatggcaccacatatcgccttcccgatgcgctttcgtctgccgcaccgcccgcat
ctgcgtccggcgtggatgatccgcaccggtctgtttatgtacgaccacctcggcaagcgc
accagtctgccgggttctactggtttgcgttttggttcggattccgttctgaagccggaa
atcgtgcgcggtttcgaatattccgactgctgggtggatgacgcgcgtctggtgctcgcc
aacgcccagatggtcgttaaaaaaggcggagaagtgctgacccgcacccgtgctacctcc
gcgcgccgcgaaaatggcatgtggattgtggaagcggaagatattgataccggcgaaacc
tacacctggcaggcgcgcggcttagtgaacgccaccggcccgtgggtgaaaaacttcttc
gacgacggtctgaaactgaaatcgccttacggcatccgcctgatcaaaggcagccatatc
gtcgtgccgcgcgtgcataaccagaaacaggcttacatcctgcaaaacgaagataagcgt
atcgtgtttgttattccgtggatggatgagttctcgataatcggcacgaccgacgtcgaa
tataaaggcgatccgaaagaagtggctatcgacgaatccgaaatcagctatctgctgaaa
gtctataacgcgcacttcaaaaagcagcttggccgcgacgatgtcgtctggacttactcc
ggcgtgcgtccgctgtgcgatgacgagtccgattcgccgcaggcgatcacccgtgattac
acgctcgatattcacgatgaaaacggcaaagcgccgctgctgtcggtcttcggcggcaaa
ctcacgacgtaccgtaagcttgccgaacacgcgatggaaaaactgtcgtcttattacagc
aatatcgggccagcgtggacccgtaacgccgtgctgccgggtggcgctttccagggcgag
cgcgacgactacgctgcgcagttgcgccgccgctatccgtttatcagcgaaacgctggcg
cgccactacgcgcgtacctacggcagcaacagcgagctgattctgggcgatgccgcagat
atcaacgcgctcggcgaacactttggccacgagttctacgaagcggaactgcgctatctg
gtcgagcatgaatgggtgcgccgcctggatgacgccatctggcgtcgtaccaaactcggc
atgtggctcaacggtgaagaacagtcgcgcgtggcacagtggctcactgaaaatgtcggc
aaaaaagccaatgtgaaactgtcgctggcctcgtaa

DBGET integrated database retrieval system