KEGG   Cronobacter malonaticus CMCC45402: P262_00413Help
Entry
P262_00413        CDS       T02955                                 

Definition
(GenBank) peptidoglycan synthetase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00550  Peptidoglycan biosynthesis
csi01100  Metabolic pathways
csi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    P262_00413
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    P262_00413
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csi01003]
    P262_00413
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csi01011]
    P262_00413
Enzymes [BR:csi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     P262_00413
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     P262_00413
Glycosyltransferases [BR:csi01003]
 Polysaccharide
  Bacterial polysaccharide
   P262_00413
Peptidoglycan biosynthesis and degradation proteins [BR:csi01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   P262_00413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AHB68653
UniProt: V5TU66
LinkDB All DBs
Position
complement(318885..321437)
Genome map
AA seq 850 aa AA seqDB search
MKFVKYLFFLAVFCILLGAGSIYGLYKFIEPQLPDVATLKDVRLQIPMQIYSADGELIAQ
YGEKRRIPLTLNQIPPEMVKAFIATEDSRFYDHHGVDPIGIFRAASVALFSGHASQGAST
ITQQLARNFFLSPERTLMRKIKEAFLAVRIEQLLTKDEILELYLNKIYLGYRAYGVGAAA
QVYFGKTVDQLSLSEIAVIAGLPKAPSTFNPLYSLERATARRNVVLSRMLSEGYISQSQY
DDARSETIDANYHAPEIAFSAPYLTEMVRQEMISRYGENAYEDGYKVYTTITRRIQQAAQ
KAVRDNVLDYDMRHGYRGPSNVLWRVGEMAWDSKKITDSLKNLPTYGPLLPAVVTSANPD
EATALLADNSSVSLKMDGVRWARPYRSDTAQGPTPRRVTDVLQAGQQIWVRKVDDSWWLA
QVPDVNSALVSINPKDGSILALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGL
TLASILNDVPISRWDAGAGSDWRPKNSPPEYAGPIRLRQGLGQSKNVVMVRAMRAMGVDY
AAEYLQRFGFPAQNIVHTESLALGSASFTPLQVARGYAVMANGGFLVDPWFISKITNVQG
EPLFEAKPKIACPDCDIPVIYGETPKSNVLENKDVENVATSAEQQNAPVPMPQLEQANRD
LVAQSPAPQYAPHVISTPLSFLIKSALNSNIFGEPGWQGTGWRAGRDLKRRDIGGKTGTT
NSSKDAWFSGYGPGVVTSVWIGFDDHRRDLGRTTASGAIKDQISGYEGGAKSAQPAWDAY
MKAALEGVPEEPLTPPPGIVTVNIDRSTGQLANGGNSREEYFIEGTQPTQQAVHEVGTTI
IDNGETHELF
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcgtaaagtatttattcttccttgcagtcttttgcattctgctgggagccggc
tcgatatacggcctgtataaatttattgagccgcagttacctgacgtcgccacgctgaaa
gatgtgcggctgcaaattcctatgcagatctatagcgctgacggcgagctgatcgcgcag
tacggcgaaaagcgccgtatcccgctgacgctcaatcagatcccgccggaaatggtcaaa
gcgtttatcgccacggaagacagtcgcttttacgatcaccacggcgtcgatccgatcggg
attttccgtgctgcgagtgtggcgctcttctccggtcacgcctcacagggcgcgagtacc
attacgcagcagctggcgcgtaacttcttcttaagcccggaacgcaccctgatgcgtaaa
atcaaggaagcctttctcgcggtgcgtattgagcaactgctgacgaaagatgagatcctt
gagctttacctgaacaagatttacctcggctatcgcgcctacggcgtgggtgccgccgcg
caggtctatttcggcaaaacggtggatcagctctccttaagcgaaatcgccgttatcgct
ggcctgccgaaagcgccatcgacgttcaacccgctctactcccttgagcgcgccaccgcg
cgccgcaacgtcgtactctctcgtatgctgagcgagggctatatcagccagtcgcagtat
gacgatgcccgcagcgaaacgattgacgctaattatcacgcgccggaaatcgcgttttcc
gcaccctacctgacggaaatggtgcgtcaggagatgatcagccgttacggcgaaaatgcc
tacgaggacggttataaggtttacaccacgattacccgccgcattcagcaggccgcgcaa
aaagcagttcgcgacaatgtgctggattacgacatgcgccacggttatcgcggcccgtct
aacgtgctatggcgcgtgggcgagatggcgtgggatagcaagaaaatcaccgactcgctg
aaaaatctgccgacttacgggccgctgctgcctgcggtggtcacctcggcgaatcctgac
gaagcgacggcgctgcttgccgacaactcctcggtgtcgctgaagatggacggcgtgcgc
tgggcgcgtccttaccgctctgataccgcgcagggcccgacgccgcgccgcgtcaccgac
gtgttgcaggcgggccagcagatttgggtgcgtaaggtcgatgacagctggtggctcgcg
caggtgccggatgtcaactcggcgctggtctccattaacccgaaagatggttcgatactg
gcgctggtgggcggctttgatttcaaccagagcaaattcaaccgcgcgacccaggcgctg
cgccaggtcggctcgaacattaagccgttcctgtatacggcggcgatggacaagggcctg
acgctcgcgagcattctgaacgacgtgccgatctcccgctgggatgcgggtgcaggctct
gactggcgtccgaagaactctccgccggaatatgccgggccaattcgtctgcgccagggc
ctgggccagtcgaaaaacgtggtgatggttcgcgccatgcgcgcgatgggcgtcgattac
gcggcggaatatctccagcgtttcggcttcccggcgcagaatatcgtgcataccgaatcg
ctggcgctcggctccgcgtccttcacgccgctgcaggttgcgcgcggctatgcggtgatg
gcgaacggcggctttttggtagatccgtggtttatcagcaaaattaccaacgttcagggc
gaaccgctgtttgaggcgaagccgaaaatcgcctgcccggattgcgatatcccggtgatt
tacggggaaacgccgaaatcaaacgtgctggaaaacaaagacgtggaaaacgtcgccacc
tctgccgaacagcagaacgcgccggtgccgatgccgcagcttgagcaggcgaaccgcgat
ctggtggcgcaaagcccggcgccgcagtatgcgccgcacgtcatcagcacgccgctgtcg
tttttgattaaaagcgcgctgaacagcaatatcttcggcgaaccgggctggcagggaaca
ggctggcgcgccggacgcgatctcaaacgtcgcgatatcggcggtaaaaccggtacgacc
aacagctcaaaagacgcctggttctccggttatggtccgggcgtggtgacgtctgtgtgg
attggctttgacgatcaccgccgcgatctcggccgcaccacggcctcgggtgcgattaaa
gaccagatctctggctatgagggtggcgcgaaaagcgcgcagcctgcgtgggatgcgtat
atgaaggccgcgctggaaggcgtgccggaagagccgttaacgccgccgccgggcatcgtg
acggttaatatcgaccgcagcactggccagctggcgaatggcggcaacagccgtgaagag
tactttatcgaaggcacgcagccgacccagcaggcggtgcatgaagtcggcacgacgatt
atcgataacggggaaacccacgagctgttctga

DBGET integrated database retrieval system