KEGG   Cronobacter malonaticus CMCC45402: P262_03125Help
Entry
P262_03125        CDS       T02955                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi00480  Glutathione metabolism
csi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    P262_03125
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csi02000]
    P262_03125
Enzymes [BR:csi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     P262_03125
Transporters [BR:csi02000]
 Other transporters
  Pores ion channels [TC:1]
   P262_03125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_N_3 GST_C_2 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AHB70591
UniProt: V5TZB5
LinkDB All DBs
Position
2305672..2306280
Genome map
AA seq 202 aa AA seqDB search
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YQARVKARPAVEAALKAEGLSA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacattattctgcgcgaa
gccaatatcgatttcacgctggtggcggtggatctggccgctaaacgtacggaaaccggc
gaagactatctgaccattaacccgaaaggccaggtgccggcgctgctgctggatgacaat
acgctgctcacggaaggcgtggctatcgtgcagtacatcgcagatcttgtcccggaccgc
cagttgctcgcgccggttggcagcatgacccgttatcatacgctggagtggctgaactat
atcgccaccgagctgcataaaggcttcacgccgctgttccgcccggatacaccggacgag
tacaagaccattgctcgcgcgcagctgcagaagaaattcgcgtacgtgaatgaggcattg
gcgcagaaacagtggctgatggggctacgtttcagcgtggcggatgcgtatctgtttacc
gtgctgaactgggcgaaagcggtcgggcttgagatgcaggcgtttgacaatattgctgac
taccaggcgcgcgtcaaagcgcgtcctgccgtcgaggcggcgctcaaagcggaaggcctg
agcgcgtaa

DBGET integrated database retrieval system