KEGG   Cronobacter malonaticus CMCC45402: P262_03140Help
Entry
P262_03140        CDS       T02955                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csi  Cronobacter malonaticus CMCC45402
Brite
Enzymes [BR:csi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     P262_03140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHB70602
UniProt: V5U0C5
LinkDB All DBs
Position
complement(2315512..2316030)
Genome map
AA seq 172 aa AA seqDB search
MKRLTLAAMVLLACGAAQAASEEVELRLATDKGVGESVGMVKITETEKGLEFAPDLKGLP
PGDHGFHIHAKGSCEPAMKDGKMVAAEAAGGHFDPQNTGKHAGPEGDGHLGDLPVLAVNN
DGKATDPVTAPRIKTLDEVKGKALMVHVGGDNLSDHPKPLGGGGARYACGVI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgattgacactggcggcgatggtgctgctggcatgcggcgccgcacaggccgcc
agcgaagaagtggaactgcgtctggccactgacaaaggcgtcggtgagtcagtcggcatg
gttaaaatcaccgaaaccgagaaaggcctggagtttgcgcccgatctcaagggcctgccg
ccaggcgatcacggcttccacattcatgccaaaggcagctgcgaacccgccatgaaagac
ggcaaaatggtcgcggcagaagcggctggcggtcatttcgacccgcaaaataccggtaaa
cacgccgggccggaaggcgacggacatttaggcgatctgccggtccttgccgttaataac
gatggcaaagccaccgacccggtcaccgcgccgcgtatcaaaacactggacgaagtgaag
ggtaaagcgctgatggtacacgtcggcggcgataacctgtccgatcatccgaaaccgctg
ggtggcggtggtgcccgttacgcctgcggcgttatttaa

DBGET integrated database retrieval system