KEGG   Cronobacter malonaticus CMCC45402: P262_05078
Entry
P262_05078        CDS       T02955                                 

Definition
(GenBank) DNA polymerase III subunit chi
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
csi  Cronobacter malonaticus CMCC45402
Pathway
csi03030  DNA replication
csi03430  Mismatch repair
csi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:csi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    P262_05078
   03430 Mismatch repair
    P262_05078
   03440 Homologous recombination
    P262_05078
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csi03032]
    P262_05078
   03400 DNA repair and recombination proteins [BR:csi03400]
    P262_05078
Enzymes [BR:csi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     P262_05078
DNA replication proteins [BR:csi03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     P262_05078
DNA repair and recombination proteins [BR:csi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     P262_05078
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AHB71973
UniProt: V5U3L3
LinkDB
Position
3788572..3789033
AA seq 153 aa
MKNATFYLLDNDDTADGLSAVEQLVCDVAAARWRAGKRILIACVDEAQATRIDEALWKRD
PDSFVPHNLAGEGPRGGAPVEIAWPQKRGSSPRELLISLLPEFAAFATAFYEVVDFVPYD
ESQKQLARERYKAYRAAGFHLTTATFTAPGTTQ
NT seq 462 nt   +upstreamnt  +downstreamnt
atgaagaacgcaacgttttacctgctggacaacgacgacaccgcggacggcctgagcgcc
gtggaacaactggtgtgcgacgttgccgccgcgcgctggcgcgcagggaaacgcatcctg
attgcctgcgttgacgaagcccaggcgacccgcatcgacgaagcgctctggaagcgcgac
ccggacagcttcgtgccgcacaatctggcaggcgaagggccgcgcggcggcgcgccggtt
gagatagcctggccgcaaaaacgcggcagcagcccgcgggagctgctgataagcctgctg
ccggagtttgcagcttttgccactgctttctatgaagtggtagacttcgtaccttacgac
gaatcccagaaacaactggcgcgcgaacgctacaaagcctatcgcgccgctggtttccac
ttgaccacggccaccttcacggcgcccggaacgacacagtag

DBGET integrated database retrieval system