KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_00667Help
Entry
CSK29544_00667    CDS       T03903                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
csj  Cronobacter sakazakii ATCC 29544
Brite
KEGG Orthology (KO) [BR:csj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:csj03012]
    CSK29544_00667
   03029 Mitochondrial biogenesis [BR:csj03029]
    CSK29544_00667
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csj04147]
    CSK29544_00667
Translation factors [BR:csj03012]
 Eukaryotic Type
  Elongation factors
   CSK29544_00667
 Prokaryotic Type
   CSK29544_00667
Mitochondrial biogenesis [BR:csj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CSK29544_00667
Exosome [BR:csj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CSK29544_00667
  Exosomal proteins of breast cancer cells
   CSK29544_00667
  Exosomal proteins of colorectal cancer cells
   CSK29544_00667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: AKE93631
UniProt: A0A2X1J5G0
LinkDB All DBs
Position
complement(691092..692276)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgttctggcgaaaacctac
ggtggttctgctcgtgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgtt
gactgcccgggccacgccgactacgtgaaaaacatgatcaccggtgctgctcagatggac
ggcgctatcctggttgttgctgcgactgacggcccgatgccgcagacccgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgctgagtgggaagcgaaaatcatcgagctggcaggtcacctggattcctacatc
ccggaaccggagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaggttggt
gaagaagttgaaatcgtgggcatcaaagacaccgcgaaatccacctgtaccggcgttgaa
atgttccgcaaactgctggacgaaggccgtgcgggcgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggctccatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagatgaaggcggccgtcac
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtggagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgcgaaggc
ggccgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system