KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_01174Help
Entry
CSK29544_01174    CDS       T03903                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00250  Alanine, aspartate and glutamate metabolism
csj00410  beta-Alanine metabolism
csj00640  Propanoate metabolism
csj00650  Butanoate metabolism
csj01100  Metabolic pathways
csj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSK29544_01174
   00650 Butanoate metabolism
    CSK29544_01174
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CSK29544_01174
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSK29544_01174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csj01007]
    CSK29544_01174
Enzymes [BR:csj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CSK29544_01174
Amino acid related enzymes [BR:csj01007]
 Aminotransferase (transaminase)
  Class III
   CSK29544_01174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AKE94135
LinkDB All DBs
Position
1257537..1258802
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRQSATPRGVGVMCGFYAEKADNATLWDVEGNEIIDFAAGIAVLNTGHRHPR
VVEAIENQLRAFTHTAYQIVPYESYVALAERINACAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVSVD
DAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMEALRALCDEHGILLIADEV
QSGFARTGKLFAMEHYGVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEQENLCQRANELGQHLQEVLNQARTYCPAIAEVRGQGSMVAVEFND
PQTGKPSPEFTQQVLTRAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRALG
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaattcagaattgaaccaacgtcgtcagagcgccaccccacgtggcgtcggtgtc
atgtgcggcttctatgccgaaaaagccgacaacgccaccctgtgggacgtggaaggcaac
gagattatcgacttcgcagcggggattgcggtgctgaacaccggccatcgccatccgcgc
gtggtggaggccatcgaaaaccagctgcgcgcctttacgcacacggcgtaccagatagtc
ccttacgaaagctatgtggcgcttgcggagcgcatcaacgcctgcgcgccgattgacggc
ccggcgaaaaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtgaaaatc
gcgcgcgcgtatacccgtcgccctggcttaatcacttttggcggcggctttcacgggcgc
acgtttatgacgatggcgctcaccggcaaagtggcaccgtacaaaatcggcttcggcccg
ttcccgggctcggtgttccacgcgcaatacccgaacgcgctgcacggcgtgtcggtggat
gacgcgatggcaagcctggagcgtattttcaaagccgatatcgcgccggatcaggtcgcg
gccatcgtgctggagccggtacagggcgaaggcggtttcaacgtcgcgccgccggcgttt
atggaggccctgcgcgcgctgtgcgacgagcacggcattctgctgattgccgatgaagtg
cagagcggctttgcgcgcaccggcaaactgttcgcgatggagcattacggcgtgaagccg
gatctgctgacgatggcgaaaagccttgcgggcgggatgccgctctcgggcgtggtcggg
cgcgcggaagtgatggacgcgcctgcgccgggcggccttggcggcacctacgccggtaac
ccgctggcggtggcggcggcgcacgcggtgctggatgtgattgagcaggaaaatctctgc
cagcgcgcgaacgagctgggccagcatttacaggaagtgctcaaccaggcacgcacctac
tgcccggcgattgccgaagttcgcgggcagggctcgatggtggcggtagagtttaacgat
ccgcagaccggcaagccgtcgcctgagtttacgcagcaggtgctgacgcgcgcccgtgaa
gaggggctgctgctgctgagctgtggtgtttacggcaacgttatccgtttcctttacccg
ctgaccattccggatgcgcagttcagcaaggcgctggagatcctctcccgcgcgctgggg
cgctaa

DBGET integrated database retrieval system