KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_01205Help
Entry
CSK29544_01205    CDS       T03903                                 

Definition
(GenBank) aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00564  Glycerophospholipid metabolism
csj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CSK29544_01205
Enzymes [BR:csj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CSK29544_01205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AKE94166
UniProt: A0A384EMP4
LinkDB All DBs
Position
complement(1294735..1296252)
Genome map
AA seq 505 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
TGLRFGSDSVLKPEIVRGFEYSDCWVDDARLVLANAQMVVKKGGEVLTRTHATSARRENG
MWIVEAEDIDTGETYTWQARGLVNATGPWVKNFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKEVAIDESEISYLLKVYNAHF
KKQLARDDVVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHAMEKLSSYYSNIGPAWTRNAVLPGGAFQGERDDYAAQLRRRYPFISETLARHYART
YGSNSELILGDAADIHALGEHFGHEFYEAELRYLVEHEWVRRLDDAIWRRTKLGMWLNGE
EQSRVAQWLTENVGKKANVKLSLAS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtgggggcatcaacggtgccggtatcgcggca
gacgccgcagggcgtggactctctgtgctgatgctggaagcgcaggatctggcgtgcgcc
acttcttccgccagctccaagttgatccacggcgggctgcgctatctggaacattacgag
ttccgtctggtcagcgaagcgctggcagaacgtgaagtgctgctgaaaatggcgccgcac
atcgcgttcccgatgcgctttcgtctgccgcaccgcccgcatcttcgcccggcttggatg
atccgcaccggtctgttcatgtacgatcacctcggcaaacgcaccagtctgccgggctcc
accggtttgcgttttggttcggattcagtgctgaagccggaaatcgtgcgcggtttcgaa
tattccgactgctgggtcgacgacgcgcgtctggtgctggcgaacgcccagatggtcgtt
aaaaaaggcggcgaagtgctgactcgcacccacgccacctccgcgcgtcgcgaaaacggc
atgtggatcgtggaagcggaagatatcgataccggcgaaacctacacctggcaggcgcgc
ggcttagtgaacgccaccggcccgtgggtgaaaaacttctttgatgacggcctgaaactg
aaatcgccttacggtatccgcctgatcaaaggcagccatatcgtcgtgccgcgcgtgcat
aaccagaaacaggcttacatcctgcaaaacgaagataagcgtatcgtgtttgttatcccg
tggatggatgagttctcgataatcggcactaccgacgtcgaatataaaggcgacccgaaa
gaagtggctatcgacgaatccgaaatcagctatctgctcaaagtctataacgcgcacttc
aaaaaacagcttgcccgcgatgacgtggtctggacctactccggcgtgcgtccgctgtgc
gatgacgaatcggattcgccgcaggcgatcacccgtgattacacgctcgatattcacgat
gagaacggcaaagcgccgctgctgtcggtcttcggcggtaaactcacgacgtaccgtaag
cttgccgaacacgcgatggaaaaactgtcgtcctattacagcaatatcggcccggcgtgg
acccgcaacgccgtgctgccgggtggcgctttccagggcgagcgcgacgactacgccgca
cagctgcgtcgccgttacccgttcatcagtgaaacgctggcgcgccactacgcgcgtacc
tacggcagtaacagcgagctgattctgggcgatgctgcagatatccacgcgcttggcgaa
cacttcggccatgagttttacgaagcggaactgcgctatctggtcgagcacgaatgggtg
cgccgtctggatgacgccatctggcgtcgtaccaaactcggtatgtggctcaacggtgaa
gaacagtcgcgcgtggcgcagtggctcactgaaaacgtcggcaaaaaagccaatgtgaag
ctgtcgctggcgtcgtaa

DBGET integrated database retrieval system