KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_02191Help
Entry
CSK29544_02191    CDS       T03903                                 

Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00071  Fatty acid degradation
csj00280  Valine, leucine and isoleucine degradation
csj00281  Geraniol degradation
csj00310  Lysine degradation
csj00362  Benzoate degradation
csj00380  Tryptophan metabolism
csj00410  beta-Alanine metabolism
csj00640  Propanoate metabolism
csj00650  Butanoate metabolism
csj00903  Limonene and pinene degradation
csj00930  Caprolactam degradation
csj01100  Metabolic pathways
csj01110  Biosynthesis of secondary metabolites
csj01120  Microbial metabolism in diverse environments
csj01130  Biosynthesis of antibiotics
csj01200  Carbon metabolism
csj01212  Fatty acid metabolism
Module
csj_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CSK29544_02191
   00650 Butanoate metabolism
    CSK29544_02191
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CSK29544_02191
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CSK29544_02191
   00310 Lysine degradation
    CSK29544_02191
   00380 Tryptophan metabolism
    CSK29544_02191
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CSK29544_02191
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CSK29544_02191
   00281 Geraniol degradation
    CSK29544_02191
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CSK29544_02191
   00930 Caprolactam degradation
    CSK29544_02191
Enzymes [BR:csj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CSK29544_02191
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CSK29544_02191
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CSK29544_02191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AKE95148
UniProt: A0A2S9UAK5
LinkDB All DBs
Position
2282388..2284541
Genome map
AA seq 717 aa AA seqDB search
MESTSAFNLQMRPDNVAVVTIDVPGEKMNTLKAEFARDVRAIVKMLRENRDLAGVVFISA
KPDNFIAGADINMIAHCQSAQEAEALASQGQQIMAEIRALPVHVVAAIHGACLGGGLELA
LACHSRICTDDAKTQLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILAGKQLRPRQAL
KAGLVDDVVPQSILLEAAAELAKKRRPAPRRLPVRERLLAGPIGRALLFRMVTQKTHQKT
HGNYPAAQRIIDVVRTGLEQGSASGYQAEARAFGELAMTPESAALRGLFFATTELKKETG
SEAAPRALHSVGVLGGGLMGGGIAYVTAIKARLPVRIKDISEKGINHALKYSWDLLEKKV
RRRHLRASERDAQMALISASTDYRGFHQRDIVVEAVFEDLTLKQNMVAEIEAHTAPHTIF
ASNTSSLPIGDIAAGAARPEQVIGLHYFSPVDKMPLVEVIPHAGTSAETIATTVQLAKKQ
GKTPIVVADCAGFYVNRILAPYINEAMRCLMEGESIEKIDEALVKRGFPVGPIQLLDEVG
IDVGTKIMPVLERAYGPRFSAPGDAVAAILNDDRKGRKNGRGFYLYPAKGRKSKKQVDPA
VYGLIGVKPGGKLSSEEIAERCVMMMLNEAARCLDEGVVRSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAAAVVATLTRLATRYGDRFTPCDRLLRMAQTGQTFWHAGNPQAEMTV
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgacatccgcatttaatttacagatgcgcccggacaatgttgcggtggtcacc
atcgacgtgccgggcgagaaaatgaatacgctgaaggcggagttcgcccgcgatgttcgc
gcgattgttaaaatgctgcgggaaaaccgcgatctcgcgggcgttgtgtttatctccgcc
aagccggataactttatcgccggtgcggatatcaacatgatcgcgcactgccagagcgcg
caggaggccgaagcgctggcaagccagggccagcagatcatggcggagatccgcgcgctg
ccggtgcatgtggtcgcggccattcatggcgcgtgcctgggcggcgggctggaactggcg
ctcgcctgccacagccgcatctgcaccgatgatgcgaaaacgcagctcgggctgccggaa
gtgcagcttgggctactgcctggctccggcggcacacagcggctgccgcgcctcgttggc
gtcagcaccgcgcttgagatgatccttgcgggcaaacagctgaggccgcgtcaggcgctg
aaagccggactggtggatgatgtggtgccgcagtctattctgctggaagccgctgccgaa
ctggcgaaaaagcgccgtcccgcgccgcgccgtctgccggttcgcgagcgtttgcttgca
ggcccgattggccgcgcgctgctgtttcgcatggtgacgcagaaaacgcatcagaaaacc
cacggtaactatccggcggcgcagcgcattattgacgtggtgcgcaccggccttgagcag
ggcagcgccagcggttatcaggccgaggcgcgcgcctttggcgaactggcgatgacgccg
gaatctgccgcgctgcgagggctgttcttcgccaccaccgagcttaaaaaagagaccggc
agcgaggccgccccgcgcgcgctgcactcggtcggtgtactgggcggcgggctgatgggc
ggcgggatcgcctatgtcaccgccatcaaagcccggttgccggtgcgtatcaaagacatc
agcgaaaagggcattaaccatgccctgaaatacagctgggatctgcttgagaaaaaagtg
cgccgccgtcatctgcgcgccagcgagcgcgacgctcaaatggcgctcatctccgccagc
accgattaccgtgggtttcaccagcgcgatatcgtcgtggaagcggttttcgaagattta
acgcttaagcaaaacatggtggcagaaatcgaagcgcataccgcgccgcatacgattttc
gcctctaacacctcgtcgctgcctatcggcgatatcgccgcaggtgccgcgcgcccggag
caggtcattggcctgcactacttcagcccggtggataaaatgccgctggtggaagttatc
ccgcacgcgggcaccagcgcggaaaccattgccaccaccgttcagcttgccaaaaaacag
ggcaaaacgccgatcgtggtggccgactgcgccggattctacgttaaccgtatcctggca
ccctacatcaatgaggcgatgcgttgcctgatggaaggggagagcattgagaaaatcgac
gaggcgctggtcaaaagaggctttccggtggggccaattcagttgcttgatgaagtgggc
attgatgtcggcaccaaaattatgccggtgctggagcgcgcttacgggccgcgattcagc
gcgccgggagacgccgttgcagcaattttgaatgacgatcgcaaaggcagaaaaaatggc
cgcggtttctatctttatccggcgaaagggcgtaaaagcaaaaaacaggttgaccctgcg
gtttacgggcttattggcgttaaacccggcgggaaactgagcagcgaggagattgccgag
cgctgcgtcatgatgatgcttaacgaggcggcgcgatgtctggatgaaggcgtggtgcgt
tccgcgcgagacggcgatatcggcgcggtgtttggtatcggttttccgccgtttcttggc
ggcccgttccgctatatggacacgctcggcgcggcggccgtggtggcgacgctcacacgt
cttgccacccgttatggagaccgttttaccccgtgcgacaggctgttgcgcatggcgcag
accggacaaacattttggcacgcggggaacccgcaagctgaaatgacggtctga

DBGET integrated database retrieval system