KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_03167Help
Entry
CSK29544_03167    CDS       T03903                                 

Definition
(GenBank) hypothetical protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00500  Starch and sucrose metabolism
csj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CSK29544_03167
Enzymes [BR:csj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CSK29544_03167
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CSK29544_03167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AKE96116
UniProt: A0A0F6VV32
LinkDB All DBs
Position
3264828..3266432
Genome map
AA seq 534 aa AA seqDB search
MSRLWHQNAVIYQIDPTRFFDSNADGWGDLRGIVEKLDYVESLGATAIWLTPFYLSPRRD
NGYDVENHTEPDPRIGSLDDVEWLIAEAEKRGIRVIIELVAQHTSDAHDWFQEARKGRDN
PFHDYYLWRDTPGPDEPAPMFPTIEPHIWRWDEQAQRYYRHLFYHHEPDLNLRHPDVIQA
VDHVLRFWAEKGVAGFRVDAASHMVEQASLPGDKESGYRLFNHFYDLLTEEHPDMILLGE
VDVNVSEFEDFFGGGERLTTLLNFWINKNTILALAREEAAPLVKALNELPMPPANGGYCF
WLRNHDELDLEDLEPEDYDFVMEKYAPDPDMRIYGRGIRRRLAPMLDGNERQQAMANALL
FSLPGTPVVRYGAEIGMGDLLSQPERESVRTPMQWNAGPGAGFSACDPARFVEPLITDGP
FRYQAINVEEQEARDGSLLHRIRQIIAVWRTLPEICYQHFHPFTVQEKSVFAVRYQNHNV
ATLMLTNLSHEAVTVDLGELNLEGAGEILADDEYPPVACSLRINGYGYRWLRVK
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtctgtggcaccagaacgccgtcatttaccagatagatcccacccgctttttt
gacagcaacgccgacggctggggagacctgcgcggcattgtcgaaaagctcgactatgtt
gaatcgcttggcgcaaccgccatctggctgaccccgttttatctctcgccgcgtcgggat
aacggctatgacgtggaaaaccacaccgagccagacccgcgtatcggctcgctggacgat
gtcgagtggctgatagccgaggcggagaagcggggaattcgtgtgattatcgaactggtg
gcgcagcacacctcagatgcccacgactggtttcaggaggcgcgcaaaggccgcgacaac
ccgtttcatgactactatctgtggcgcgacacgccaggcccggatgaacccgcgccgatg
tttccgacaatcgagccgcatatctggcgctgggatgagcaggcacagcgctactaccgc
catctcttttaccatcatgagccggatctcaacctgcgccacccggacgtgattcaggct
gtcgatcacgtgctgcgcttctgggccgaaaaaggcgtggcgggctttcgcgtcgatgcc
gcttcgcacatggtggaacaggccagcctgccgggtgataaagagagcggctaccggctg
tttaaccacttctacgacctgctgacggaagaacatccggatatgatcctgcttggcgaa
gtggacgtgaacgtctcggaatttgaagatttcttcggcggcggcgaacgcctgaccacg
ctgcttaatttctggatcaacaaaaacaccattctggcgctggcccgcgaagaggcggca
ccgctggtcaaagcgcttaacgagctgccgatgccgcccgccaacggcggttattgcttc
tggctgcgcaaccatgacgagctggatcttgaagatctggagccggaagattacgacttc
gtaatggagaaatacgcccccgatcctgacatgcgcatttacgggcgcggcattcgccgc
cgtctggccccgatgcttgacggcaacgaacgccagcaggcgatggcgaatgccctgctc
ttttcgctgcccggcacgccggtggtgcgctatggcgcggaaatcggcatgggcgatctg
ctttcacagccggagcgtgaatcggtgcgcacgccgatgcagtggaatgcggggccgggt
gccgggttttccgcctgcgatccggcgcgctttgtggagccgttaattaccgacggcccc
tttcgctatcaggcgataaatgtggaagagcaagaagcgcgcgacggctcgctgctgcac
cgtatccggcagattatcgccgtctggcgcacgctgcctgagatctgctatcagcatttc
cacccgttcacggtgcaagaaaagagcgtgtttgcggtgcgctatcaaaaccataacgtc
gccacgctgatgctgacgaacctgagccatgaggcggtgacggtggatttgggcgagtta
aatctggaaggcgctggcgagatactggcggatgatgagtatccgccagtcgcctgctca
cttcgcatcaacggctatggctaccgctggctgcgggtaaagtaa

DBGET integrated database retrieval system