KEGG   Cronobacter sakazakii ATCC 29544: CSK29544_03279
Entry
CSK29544_03279    CDS       T03903                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
csj  Cronobacter sakazakii ATCC 29544
Pathway
csj00480  Glutathione metabolism
csj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CSK29544_03279
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csj02000]
    CSK29544_03279
Enzymes [BR:csj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CSK29544_03279
Transporters [BR:csj02000]
 Other transporters
  Pores ion channels [TC:1]
   CSK29544_03279
SSDB
Motif
Pfam: GST_C GST_C_3 GST_N GST_C_2 GST_N_3 GST_N_2 GST_C_6
Other DBs
NCBI-ProteinID: AKE96228
UniProt: A0A384F7H9
LinkDB
Position
3387450..3388058
AA seq 202 aa
MKLFYKAGACSLSPHIILREANIDFTLVAVDLAAKRTETGEDYLTINPKGQVPALLLDDN
TLLTEGVAIVQYIADLVPDRQLLAPVGSMTRYHTLEWLNYIATELHKGFTPLFRPDTPDE
YKTIARAQLQKKFAYVNEALAQKQWLMGLRFSVADAYLFTVLNWAKAVGLEMQAFDNIAD
YHARVKARPAVAAALKAEGLSA
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaactgttttacaaagccggcgcgtgttcgctttcgccgcacatcattctgcgcgaa
gccaatatcgattttacgctggtggcggtggatctggccgccaaacgcacggaaactggc
gaagactatctgactatcaacccgaaaggtcaggtgccggcgctgctgctggatgacaat
acgctgctgacagaaggcgtggctattgtgcagtacatcgcagatcttgtcccggaccgt
cagttgctcgcgccggttggcagtatgacccgttaccatacgctggagtggctgaactat
atcgccaccgagctgcacaaaggctttacgcccctgttccgcccggatacgccggatgag
tacaagaccatcgcacgcgcgcagctgcagaagaaattcgcgtacgtgaatgaggcgctg
gcgcagaaacagtggctgatggggctgcgcttcagcgtggcggatgcatatctgtttacc
gtgctgaactgggcgaaagcggtcggacttgagatgcaggcgtttgacaatatcgctgac
taccatgcccgcgtgaaagcgcgccctgccgtggcagccgcgctcaaagcggaaggtctg
agcgcgtaa

DBGET integrated database retrieval system